KEGG   Danio rerio (zebrafish): 796425Help
Entry
796425            CDS       T01004                                 

Gene name
card9
Definition
(RefSeq) caspase recruitment domain-containing protein 9
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04621  NOD-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    796425 (card9)
   04625 C-type lectin receptor signaling pathway
    796425 (card9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2 ADIP
Motif
Other DBs
NCBI-GeneID: 796425
NCBI-ProteinID: NP_001103755
ZFIN: ZDB-GENE-060531-94
Ensembl: ENSDARG00000067672
UniProt: A2CE85
Position
5
AA seq 534 aa AA seqDB search
MSDGPGVFEVEEDDECWARLEDYRMLLIKTIEPSRITPYLRQCKVLSSEDEEQIYNDPSL
VIRRRKVGVLLDILQRTGLKGYEAFLESLELDYPDVYRKITGKEPARVFSVLIDTAGECG
LTQFLMSEVSRLQKLAQDERRARLEVSAQVKEQHETIRQLQLCENELHKQQERVHRIREE
RERMCEEARTLKDENYRLMHDLTRLSEEKNCALMCNRDLQLEIEKLKHSLMNAESDSKIQ
RKKTVNLKNAMEQRPSPEIIWKMQRQNDLLKARIQELESASKVQTPEQEKPDSQTLEDFK
QQSQAQYQELVNDLYNLRRDLHDAEKLRDKYREEKDELELKCLMLKKDSKMYGDRMEDIL
KQLEEVIKERDKAICTREEYHLENSKNLQDKDQYRKQIREMGERYDELQVQLFRTQGEVL
ALQATLRKQKSPIRVNSGESSLLSSFELKSSEEESRERGEKDMSEESQSQTSGEFNVRFS
RRVSGEDISDNCKNNRKCNFHYRRKRALRTKRCTDKDNMQGLLDNTTGSDTDGM
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatggtccaggggtttttgaggtggaggaagatgatgagtgttgggctcggctg
gaggactaccgaatgcttctcatcaagaccattgagccctcaaggataacaccttatctg
agacagtgcaaggtgctgagcagcgaggatgaggagcagatctacaatgatccaagtttg
gttatcagacgccgcaaagttggtgtgctgttggacatattacaaagaactgggctcaaa
ggatatgaggcttttctagaaagcttggagttagactacccagatgtgtaccgcaagatc
accggtaaagagcctgcaagggtgttctctgtacttattgacactgctggtgaatgcggc
ctcactcagttcctcatgagcgaggtgtctcgtctgcagaagctggcgcaggatgagcgg
agggcccgactggaagtatctgcacaggtaaaggagcagcacgaaaccatccgccagctg
cagctgtgtgaaaatgagctgcacaaacagcaggagcgtgtgcaccgcatccgagaagag
cgcgagcgcatgtgtgaggaggctcggacactgaaagatgagaattaccgactgatgcac
gatctgactcgactgagcgaagagaagaactgcgcgctcatgtgtaacagagacctccag
ctagagatcgagaaattaaaacacagcttaatgaatgccgaaagtgattcaaagattcaa
cggaaaaagactgtaaacttgaaaaatgccatggagcaaaggccgagtccagagatcatc
tggaagatgcagagacaaaacgacctccttaaagctcgcatacaagagctcgaaagtgct
tccaaggttcaaactcctgagcaggaaaagcctgattcacagacattagaggatttcaag
caacaaagtcaggcacaataccaagagctggtgaatgatctctacaatctaagaagagat
cttcatgatgcagaaaagctgcgtgataagtatcgagaagagaaggatgagttagaactt
aagtgcttaatgctaaagaaggactctaagatgtatggagaccgaatggaagacattctg
aaacagctggaagaggtgatcaaagaaagagacaaggctatttgtacgagagaggagtac
catctggaaaactcaaaaaatctccaagacaaagaccagtaccgcaagcagatccgggaa
atgggagaacgctatgatgaacttcaagtccagttgtttcgaactcaaggagaagttctt
gctcttcaagctacacttcgcaaacagaagagccccattcgagtgaactcaggagagagt
tccttgctgagttcatttgagctgaaaagtagcgaggaggagtccagggaaaggggtgaa
aaggatatgagtgaagagtcacagagccagacatccggcgagttcaatgtacgtttctct
aggagggtttctggggaggacatctcagataactgcaaaaataatagaaagtgcaacttc
cattacaggaggaaacgtgctttaagaactaaaagatgcacagacaaagacaatatgcaa
ggcctcctagacaacactaccgggagtgatacagatgggatgtga

DBGET integrated database retrieval system