KEGG   Danio rerio (zebrafish): 797406
Entry
797406            CDS       T01004                                 

Gene name
espl1
Definition
(RefSeq) separin isoform X1
  KO
K02365  separase [EC:3.4.22.49]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04110  Cell cycle
dre04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    797406 (espl1)
   04114 Oocyte meiosis
    797406 (espl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    797406 (espl1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    797406 (espl1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     797406 (espl1)
Peptidases and inhibitors [BR:dre01002]
 Cysteine peptidases
  Family C50: separase family
   797406 (espl1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    797406 (espl1)
SSDB
Motif
Pfam: Peptidase_C50 CHAT TPR_12
Other DBs
NCBI-GeneID: 797406
NCBI-ProteinID: XP_001337869
ZFIN: ZDB-GENE-030131-5188
Ensembl: ENSDARG00000075354
Vega: OTTDARG00000038476
UniProt: E7FDD8
Position
6
AA seq 2182 aa
MALKSLKTEDYVQQLSCVKDTIVLHNELKKHVDGGLGPYGRTMCDRIIRACNQRLGNGAV
DAGLQERIVELVELAVQGFQLLEESGMQSTPFYLEKIVFHILQKVASLGAHGPACRLGQL
VYRRLKCLSAEIDDFNVLVRNCFAVLWNSLLSNKPSASTLPPRDRLHCQLQALTFRLLEQ
GSSSSSSPSKVPLFVEEAVVEYERSCGGFTQDDVSFLTSELRELFSGAFINPQDSASTSS
LLAVWCEVAFKVSKLLCKSSFSPEAVELLRGTLKEVNGHVGLRSALGLADRAVQMQCVLS
SGGECSKSFTECARALRMLPCAMSSSESHALLEACQLVVWTLEASQCKGMDVTTLLACFS
FLEEYQEFLLAQQKNSFSLQVQYSLCFSFYQGFICTYDSLHASQVSVGETLDRVLLFCRS
TAGRMLAELRTLNNDNLLLKAVCAVNNVVYELFNRKLYEGAFGLSMIVCQELCKDCPPSL
PMDRVNRCFMLTVQCSRRAGHLEQALDWIVRWIQALGSQILDHLTEPVSMWVKTKCDAAR
AGEDDTRLRTLRDGLGESLVDEEVMMCLLEEELRVYKEQTGDTAQERYNTLCDLLEICHE
ETPHTLRRATYLCEMAQVVCYQDFSQQTDCSAVDFTHEALRLLEAEPETAENTDRLKDEK
AHASLWLYICTLESNLQEAVDTEKRLCAVQEENKRDVNMDPVPTNDLEYEDKQKSQESQL
VYDGLRFNLLAHSKQSEPLDKCLSLWRSLLKGAVPAVRDPKLTASSMTLMAALYTLMGKH
LQALEGYQLAATLFHVLGDGQSSANAFCHSTRILLYLGSPQLAQVDLEKAEKSLSSVTIS
EGTSIISMLAMLQKAQLHYALGQVESGVSCLMEVIKESAQHHSKSWYLLRARALQTASEY
LSLDTLALNSQLRQSIMQQGLKTPDTAQYEGLKLLCSLVMMLLGNGFYGAPGPNTDTRFV
DKGDSVVFKWLLLSEVLVCSERMVITRSSSGAVHEAKAQCLEALKLATKLQTLSHCAELL
VLKAELELMKGATEASSLDLEQVRHLLDLCTDFGQGRQQKSEVKIKPRKGRPAAPSSSGH
ISEEEDDLSGILSSRALPKEPVENMARLGSQGASPPLKPKCQHGLSCLTHEETCSCLCCT
ELSVARVSIHWALLQADLQTDPERSLRLRQSARKRCRYVVTKLQRSLAALVHSKKSPNVC
LSLLQAEQGKVHLGAVLQLLRTGDKGKAAILWEEIEAGLEAVTPKGALTPELGPIRATLL
GAKAVACCLALAMKKQCIPEELFSSLWHWNPPKVKPQLKSKHRSKSPDAAPLEAGVKHNP
KVKSGLEENESRKTKETTVISKKAKDSVPKITITKSSMVFKTPKATRTTRPKSVSTSTGI
SDLRAFDFNNEVPDISVNFTPSLHRSTNQSATAKSKASSKGSFQVYKDSSPAAEKAVVVP
AAPKRTKRSRFKVEFSDESDNDAAPLAVMEKSEKKKNTFKTSRTLKPTLNTIPSDTKLVS
STVDPEPSRRTRTTKKSTALPSIGGLSSEEELGVSSQTRTRRGRPKKSTSSADTEEPERM
RMIKEEEQRVLLNVSMEELRGSDTETKDTGSPDADCEVLRRDLGADFGRECFSELRRAGQ
NGSGSHTALPHATTSPADLSVETVQSYLRSSWLLLHHFPFPSLYPHICSLLAQSFGQTDP
IITAMLHAQALGVSTRHHMTRHVVNQFRKLKKSCNDVAEGLGALSLEETSGATQSKKLSA
LEQIFSFTASNPMQFPQTHCQQFTQQLEDLPAGVTVCLLSLTGVHPDEIGNTILLTRLER
GSTPITVRIPTADREQSVAGLLEEMDGVLKGQKEVSTVAEKSQWWDGRKALDARVEKMLE
EMEEALGVWRTLFLPLTSDPKLDVQVKSLQKALKSTKITRDTLKVILSASPLLSLPDLQC
LLEGMNVQDKDLLKLLQRGVAELRGREEPQGHTVLILDKYLQRLPWENIACLKSQSVTRM
PSLHAVLGHSHLREVDTSCVLSCGVNPKQVYYVLNPDGNLPDTENRFKEWFTGERTWQGV
CGRAPDPEKLQEAVTTKDLYIYIGHGAGARFLDAQRVLKVPVRTAALLFGCSSAALSVLG
QQEGTGIILSYLTAGCPLVLGNLWDVTDRDLDRFTSALLQSWLSAGSGSSLLQHLAKSRS
ATHLKHIIGAAPIAYGLPVHIH
NT seq 6549 nt   +upstreamnt  +downstreamnt
atggcattaaagagcttgaaaacagaagattacgttcagcagttatcctgtgtcaaggac
accatagtcctccacaacgaactgaagaaacatgtggatggtggcttgggtccttatggt
cgcacaatgtgtgatcgtatcatcagagcctgcaaccagcggctgggcaacggcgctgtg
gatgctggccttcaggagcggatagtggagctggtggaactggctgtccaagggtttcaa
ctgcttgaagagtccggcatgcagagcacccccttttatctggagaaaatagtctttcac
atcctacagaaagtcgcaagccttggagctcatggtcctgcttgtcgactgggtcagctc
gtgtatagaagactgaaatgtttgtctgcagagattgatgactttaatgtcctggtgcgg
aattgctttgcagtcttgtggaacagtctcctctctaacaaaccgagtgcttccaccctc
cctccacgagacagactccactgtcagctgcaagctttaacattcagactccttgaacag
ggctccagctcgtcctcttccccatccaaagttcctctgttcgtggaggaagcagtagtg
gagtacgaacgatcatgtggaggttttactcaagacgatgtgagttttctgacctctgaa
ttgcgtgagctgttctctggtgctttcatcaatcctcaggactctgcatcaacttcttca
ctgctggctgtgtggtgtgaggtggcatttaaagtgtctaaactgctctgcaaaagtagc
ttttcacctgaggctgttgaactcttgcgaggcactctgaaggaggttaatggccacgtt
ggcctgcgttcggctctgggtctggcagaccgggcagtgcagatgcagtgtgtgttaagt
tctggaggtgaatgcagtaagagcttcactgaatgtgcccgtgctctccggatgttgcct
tgtgccatgtccagctcagagtctcatgccctgttagaggcttgtcagctggtggtttgg
acgttggaagccagtcagtgtaaaggaatggatgtgaccactttgctggcttgtttttcc
tttttggaagaatatcaggaatttctgcttgcacagcaaaagaactcgttttcgctgcag
gtccaatactctctttgtttcagtttttaccagggcttcatctgcacatatgatagtctt
catgcttctcaggtgtctgtgggcgagaccttggacagagtgctattgttctgccggtcg
accgcaggacgtatgcttgctgaactgcggacactcaataatgacaacttgctgcttaaa
gcagtgtgtgcagtgaataatgtggtgtacgagctgtttaacaggaagctgtatgaagga
gcctttggattgtcgatgattgtgtgtcaggagctctgtaaggactgcccgccctctctt
cctatggatcgggtcaaccgctgtttcatgctgacagtgcagtgtagtcgccgcgcaggc
catctggagcaggctctggactggattgttcgctggattcaggctttgggctcacagatt
ttggatcatctcactgaacctgtgtcgatgtgggtcaaaactaagtgtgatgccgccaga
gcaggcgaggatgacacacgcctgaggactctgagggacgggttaggagaatccttagtg
gatgaggaggttatgatgtgtttgttagaggaggagttgcgtgtatataaggagcagact
ggagacacagcacaggaacgctacaacacactctgcgacctcttggaaatctgccatgaa
gaaaccccacacacactaagaagagctacgtatctgtgtgagatggcacaggttgtgtgc
tatcaggacttcagccagcagactgactgctcagcagttgattttacccacgaggctttg
cggttgctggaagcagaaccagagacggcagagaatactgataggctgaaggatgagaaa
gcccacgcttccctgtggctctatatctgcactcttgagtctaacctgcaggaggctgtg
gacacagagaagcgtttgtgtgcagtgcaggaggagaataaaagagatgtgaatatggat
cctgttcccacaaatgatctggagtacgaggacaaacagaaatcacaagagagccagtta
gtctacgatggactacgcttcaacctgctggctcacagcaagcaaagtgaacctctagat
aaatgtttgtctctatggcggagtctcctcaagggggctgtgcctgcagttagagaccct
aaactcacagcttcttccatgactttgatggctgccctatacacacttatgggcaagcac
ctgcaagctctggagggatatcagcttgctgccacccttttccatgtacttggtgatggc
cagagtagtgccaatgccttctgccactctaccaggatcttgctttacctgggttcaccg
cagcttgcacaggtggacttagaaaaagcagaaaagagcttgtcatctgtcaccatctct
gagggcacatctattatctccatgctggccatgttgcaaaaagcacagctacactatgct
ctaggacaggtggagagtggcgtgtcctgcctgatggaggtgataaaggaatctgctcag
catcattctaagagctggtacctgctcagggctcgagcactgcagacagccagtgaatac
ttgagtctggacacactggctttgaactcacagctacgccagagcatcatgcagcagggt
ctaaagactccagacactgctcaatatgaagggttgaagctgttgtgtagcctggtgatg
atgttattgggcaacgggttttacggagcgcctggaccaaacactgacactcgctttgtg
gataaaggagacagtgttgtgtttaagtggctgctgctgagtgaagtgctggtgtgctcg
gagagaatggtgatcaccaggagcagcagcggagccgttcatgaagctaaagctcagtgt
ctagaggctctcaaactggccaccaaactacagacactcagccactgtgctgagctgttg
gtgctgaaggcagagctggagctgatgaagggtgcaactgaagctagtagtttagaccta
gagcaagttagacatttacttgatctctgcacagattttggccagggacgacaacagaaa
tctgaagtgaaaatcaaaccacgcaaaggtcgtcccgctgccccttcttcctctggtcac
atctctgaggaagaggatgatctgagtgggatcctcagctctcgtgcccttccgaaggag
cctgtggagaacatggctagattaggaagccaaggagcttctccccctctaaagcccaaa
tgccagcatggcctctcctgtctgacccatgaagagacctgctcttgtctctgctgcact
gagctcagcgtggctcgagtcagcatccactgggcactattacaggcagatctccagaca
gatcccgaacgctctctcagactacgccagtctgccaggaaacgctgccgctatgttgta
actaaacttcagagaagtttggcagcacttgtacactccaaaaaatcacctaatgtctgc
ttgtcactgcttcaggctgaacagggtaaagtgcatctgggtgctgtgcttcaactgctc
agaactggagacaaagggaaagctgccatcttgtgggaggagatagaagcaggattagag
gcagtgacacctaaaggagcactgacaccagaacttgggcctatcagagctactctactg
ggggctaaagccgtagcctgctgcttggcgttggcaatgaagaaacagtgtatacccgaa
gagctgttttcttcattgtggcactggaatccaccaaaggttaaaccgcaattaaaatct
aagcatcgatccaagagtccggacgcagctcctctagaggcaggtgttaaacataaccct
aaagttaagagtggacttgaggagaatgaaagcagaaaaaccaaagagaccactgtcatt
tcgaagaaagctaaagactctgtgcccaaaattaccatcacaaaatcctccatggttttt
aaaacgcccaaagcaacgagaacaacccggcccaaatctgtctccactagcactggcatc
agtgacctgagagcatttgacttcaataatgaggtgcctgacatttcagtcaacttcaca
ccatcattacaccgatctacaaaccaaagtgcgactgcaaagtcaaaagcgtcctcaaag
ggttcgttccaggtttacaaagattcttctcctgctgcagagaaagctgtagttgtcccg
gctgctcctaaacgaacaaagcgttctcgcttcaaggttgagttcagcgatgaaagcgac
aacgatgctgctcctcttgctgtaatggaaaagtcagagaaaaagaaaaacacctttaaa
acatcacgcaccttgaaaccaacccttaacaccatccctagtgacaccaaacttgtgagc
tccacagtagatccagaaccctccagacgaacacggaccactaagaaaagcacagctctt
ccctccattggtggcctctcttctgaggaagaacttggagtatcttcacagacacgtacg
cgtagaggacgaccaaagaagagcaccagctcagcagacacagaggagccagagaggatg
aggatgattaaggaggaagaacagagggttcttttgaatgtcagcatggaggagctcaga
ggctctgacactgagacaaaagacactggaagtccagatgctgactgtgaggtcttgagg
agagatctaggtgcagattttgggcgagagtgtttcagtgagctcaggagagctggacag
aatggatcaggatctcacacagctctgccacatgcaactacatctcctgcagacttgtca
gtagagacggtccagtcatacctgcgctcctcatggctcctcctgcaccacttcccgttt
ccttctctttatcctcacatctgctcattactcgctcagtcattcggtcaaacggacccc
atcatcacagcaatgctgcatgcacaggcactgggagtgtccactcgccaccatatgacc
cgtcacgtggttaaccagttcagaaagttgaagaaatcctgtaacgatgtagcagaaggt
cttggagctctgagtctggaggaaacatctggagcaacgcagtcaaagaaactctctgcg
ttggagcagatcttttcattcacagcatcaaacccaatgcagtttccacagacacactgt
cagcagttcacacagcagctggaagatctacctgcaggagtgaccgtatgcttgctgtca
ctgacgggggtgcatcctgatgaaattggcaacactattcttctgacccgactggagcgc
ggctctaccccaatcacagttcgaatccccactgcagacagagagcaatctgttgctggc
ctgttggaagaaatggatggagtcttgaaaggacaaaaggaagtgagcacagtggctgag
aaatcacagtggtgggacggaaggaaggctttagatgcccgtgtggagaaaatgctggag
gagatggaagaggctttaggagtgtggcgaactctttttctgcctttgacctctgatcct
aagcttgatgttcaggtaaagagcctccaaaaggctcttaaatcaacaaagatcacacgg
gacactctcaaggtgattctatcagcgtctccactgctgtccctgccagacctgcagtgt
cttctggaaggaatgaatgtgcaggacaaggacctgctgaagctcctgcagagaggcgtg
gctgaactgagagggagggaggagccacagggacacactgttctgattttagacaagtac
ttgcagaggttgccgtgggagaacattgcttgtctgaagtctcagtcggtcactcgaatg
ccctcattacacgcggtgcttggacacagtcatctgagagaggtggatacaagttgtgtt
ctatcttgtggtgtgaaccctaagcaggtttactatgtgctaaacccagatggaaacctg
cccgacactgagaatcgcttcaaagagtggtttacaggtgaacgaacatggcagggggtt
tgtggaagggctcctgatccggagaaactacaagaggctgtgaccactaaagatctctac
atatacatcggacatggtgcaggagcccgctttctggatgcgcagagagttttgaaggtg
cctgtgaggaccgcagctcttctgttcggctgcagtagtgctgctctcagtgtgcttggt
cagcaggagggaacgggcatcatcctcagctacctgaccgctggatgtccattggtgctg
ggtaacctgtgggatgtgacagatcgtgacttggatcgattcacatcggctctgctccag
tcttggctctctgctggttctggctcttcacttcttcagcatttggcgaaatcacgcagc
gcaactcatttaaaacacataatcggtgctgcgcccattgcgtatggtttaccggtgcat
atacactag

DBGET integrated database retrieval system