KEGG   Danio rerio (zebrafish): 797422Help
Entry
797422            CDS       T01004                                 

Gene name
stambpa
Definition
(RefSeq) STAM-binding protein-like A
  KO
K11866  STAM-binding protein [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    797422 (stambpa)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     797422 (stambpa)
Peptidases [BR:dre01002]
 Metallo Peptidases
  Family M67
   797422 (stambpa)
Membrane trafficking [BR:dre04131]
 Endosome - Lysosome transport
  Others
   Others
    797422 (stambpa)
Ubiquitin system [BR:dre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    797422 (stambpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JAB USP8_dimer Prok-JAB
Motif
Other DBs
NCBI-GeneID: 797422
NCBI-ProteinID: NP_956792
ZFIN: ZDB-GENE-040426-1551
Ensembl: ENSDARG00000054501
Vega: OTTDARG00000019532
UniProt: Q6TH47
Position
10
AA seq 418 aa AA seqDB search
MSEHTDCSVSSEDRVRALTKLGSSVDVSEDVPPRRYFRSGMEIIRMANIYADEGNVEHAF
ILYNKYITLFIEKLPKHREYKTANIPEKKETMRKLKEIAFPKAEELKKLLLKQYDKEHAE
YLVRKRAEDAARAVEMLKQQEQEAQRQRLAELHQRQREQEQFSAFEEMIRRQELEKERRR
IVQEFSIPVSPTAPDVLLPDVHGPPQASLSPQTPPAGATNHQGLPAFDRSLKPSVPVSAG
HSALVNGLRQLFVPAELCQRFLKLAETNTARAVETCGILCGKLMKNAFTVTHVIVPKQCG
GPDYCDTENEEELFLIQDQNDLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIV
CSPKFNETGYFRLTDYGMDDVGTCKQRGFHPHPKDPPLFAASHHVSITDGSVTMLDLR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacacacggactgcagtgtgtcgtcagaggatcgggttcgggctcttactaaa
ctgggcagctcagtggacgtgagcgaggatgtgccgccgcgcagatacttccgctccggc
atggagatcatccgcatggccaacatctacgccgacgagggaaacgtggagcacgccttc
atcctgtacaacaaatacatcacgttgtttattgaaaaacttcccaaacatcgggaatac
aaaaccgccaacattcctgagaagaaagaaacgatgaggaaattaaaggaaatcgccttc
ccgaaagccgaagagctgaaaaagttgcttctcaagcagtatgacaaagagcacgctgaa
tatctggtgcgaaagagagcggaggatgcggctcgggctgtggaaatgttgaagcagcag
gagcaggaggctcagcggcagagactggcggagctgcatcagcggcagcgtgagcaggag
cagttcagcgccttcgaggagatgatccgccgccaggagctggagaaagagcgccgccgc
atcgtgcaggagtttagcatcccagtgtctcccactgctccagacgtactgctgccggat
gtacacggacccccacaggcctcactctcaccccagacgccccctgcaggagccactaac
catcaaggcctgccggcgtttgaccgctcgctcaagcccagtgtcccagtcagtgcagga
cacagtgcgttggttaatggcttacgacagctctttgtgcctgctgagctttgccaaagg
tttctaaagctggcagaaacgaacacggctagggcggtggagacctgcgggatcctctgc
ggaaaactgatgaagaacgccttcaccgtgacccacgtgatcgtgcccaagcagtgtgga
ggaccagattactgtgacacggagaacgaggaggaacttttcctgatccaggatcagaat
gatctcattacgctagggtggattcatacacacccgacgcagacggcctttctgtccagt
gtggatctgcacacacactgctcctatcagatgatgcttccagagtccatagccatcgtc
tgctcgcccaaattcaatgagacgggctacttccgcctgactgattatgggatggacgat
gtcggtacctgcaaacagagaggattccaccctcatccgaaggacccgccgctcttcgct
gctagtcatcacgtcagcatcacagacggcagcgtgaccatgctggacctgcggtga

DBGET integrated database retrieval system