KEGG   Danio rerio (zebrafish): 798375
Entry
798375            CDS       T01004                                 

Gene name
apln
Definition
(RefSeq) apelin precursor
  KO
K05225  apelin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
dre04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    798375 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    798375 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 798375
NCBI-ProteinID: NP_001159596
ZFIN: ZDB-GENE-070521-8
Ensembl: ENSDARG00000053279
Vega: OTTDARG00000028004
UniProt: Q4TTN8
Position
14
AA seq 77 aa
MNVKILTLVIVLVVSLLCSASAGPMASTEHSKEIEEVGSMRTPLRQNPARAGRSQRPAGW
RRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcttgacgctggtgattgtgctggtggtttctctgctgtgttcagcc
agtgctggtccaatggcctccaccgagcatagcaaagagattgaggaggtgggaagcatg
aggactcctttgcggcagaatcccgctcgagctggccggagccaaagacccgctggctgg
aggaggagacgccctcgaccccgcctctcccataaggggcccatgccattctag

DBGET integrated database retrieval system