KEGG   Danio rerio (zebrafish): 798689Help
Entry
798689            CDS       T01004                                 

Gene name
gria1a
Definition
(RefSeq) glutamate receptor 1 precursor
  KO
K05197  glutamate receptor 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    798689 (gria1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    798689 (gria1a)
Ion channels [BR:dre04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   798689 (gria1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 798689
NCBI-ProteinID: NP_991161
ZFIN: ZDB-GENE-020125-1
Ensembl: ENSDARG00000021352
Vega: OTTDARG00000028009
UniProt: Q71E65
Position
14
AA seq 914 aa AA seqDB search
MQRSLTLLCTSFLGLCFGSSFPSNINIGGLFPTESHEYEVFRFALSHHQDIPKLVPQVDM
VKLGNSFSMTYAFCSQFSKGVYAIIGVYDRKTVNMLMSFCGALHVCFVTPSFPMENSNQF
VIQLRPELQDALVGVIEHYRWSKFVYMYSSDSGLSVLQKVLDTAAEHNWLVTSVNVETMT
EASFLKVFQDLDKKKEGQIIIDCELERLTSILKKIIELGKNVKSYHYILANLGFLDIDLT
EFKKGEANVTGFQLVNYADPNVSRTVQQWMEFDNKDAKVPKRRLKYTGALTYDGVKVMST
AFQNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRIEGLTGHIQFNEKGRRT
NYSISVMELRPTGPKKVGYWNEDEKFVSTAAYMPGSNETYGLQNRTYIVTTILESPYVML
KKNHEHFTGNDKYEGYCVELAAEIAKHVGYHYILKIVADGKYGARDAETMMWNGMVGELV
YGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMC
IVFAYIGVSVVLFLVSRFSPYEWHADDCEDGAEENPNQPSSSSAQPGQNQQNQNQQSQEQ
TNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVE
RMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIAVFEKMWSYMKSADPSVFVKTTD
EGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRNPVN
LAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAM
LVALVEFCYKSRTESRRMKQSINDAMHCSTLTRMSGNGSGGENGRIVTHDFPKAVQTLPC
MSHAASMGLGASGM
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcctcacactgctctgcaccagttttctgggattgtgcttcggttccagt
ttcccaagtaatatcaacataggagggttattcccaaccgaatcacacgaatatgaagtg
tttcgttttgcgctctcgcatcaccaggatatccctaaactggtacctcaagtggatatg
gtcaaattgggcaatagcttctccatgacttatgcgttttgttcgcagttctccaaagga
gtgtacgcaatcattggcgtctacgacaggaagaccgtcaacatgttgatgtcgttctgc
ggtgcgctacacgtctgcttcgtgacgcccagcttccctatggaaaactccaaccagttt
gtcatccagctgaggcctgaactgcaggacgccctggtcggtgtaatcgagcactacagg
tggtctaagtttgtctacatgtacagctcggactctggactgtctgttctgcagaaggtt
ctggacacagcagcagagcataactggctggtgacctctgtaaacgtggagacaatgaca
gaggcttcctttctcaaagtgttccaggatctggacaaaaagaaggagggccagataatt
atcgactgtgagctggagagactcacctccattctgaagaagatcatcgagctggggaag
aatgtgaagagctaccactacatcctagcgaacctgggatttttggacattgacctgacg
gagtttaagaagggtgaggcgaatgtaacaggctttcagctggtgaattacgcagatcct
aatgtcagcaggacagtgcagcagtggatggagtttgacaataaagatgccaaagttccc
aagcgaagactgaagtacactggagctctcacatatgatggggtcaaagtcatgtccaca
gctttccagaacctccgcaggcagaggatagatatatctcgacgcggaaatgctggagaa
tgtctggccaacccaccggcaccctggggccaaggcattgacattcagagagcgcttcaa
caggttcggattgaaggcttaacaggacacattcagtttaacgagaaaggacgaaggaca
aactactctatcagtgtgatggagctcaggccgacgggaccaaagaaagtgggttactgg
aatgaggatgagaaatttgtgagcacggcggcctacatgccgggaagtaatgagacttac
ggacttcagaaccgcacatatattgttaccactattctggaatctccatatgtcatgctg
aagaagaaccatgaacatttcacaggaaacgataagtatgaaggttattgtgtggaactg
gcagcagagatcgccaaacatgtgggataccactacatactcaagatagtggctgatggg
aaatatggagccagagatgcggagaccatgatgtggaatgggatggtaggagagcttgtc
tatggtaaagctgatgtagctgtggccccgcttactatcaccttggtcagagaggaagtc
attgatttctccaagcccttcatgagcctgggcatctccatcatgatcaaaaaacccacc
aaatctaagcctggcgtcttctccttcctggaccctctggcctatgagatctggatgtgt
attgtgtttgcttacatcggcgtgagcgtggtactttttctggtcagccgcttcagtccc
tatgagtggcatgcagatgactgtgaggacggagcagaggagaacccaaaccagccgtcc
tcatcatccgcccaaccgggtcagaaccagcaaaaccagaaccagcagagtcaggagcaa
accaacgagtttggcatcttcaacagtctctggttctcactgggagctttcatgcagcag
ggctgtgacatttcccccaggtctctgtctggccgtatcgtgggtggtgtgtggtggttc
ttcacgctaatcatcatctcctcgtacacagccaaccttgctgcatttctcacagtagag
aggatggtgtcgcccatcgagagtgcagaagatttggccaaacagactgagattgcttac
ggcactctggacgcaggctccaccaaagagttcttcaggaggtcaaagattgcagtcttt
gagaagatgtggtcttacatgaagtcagcagatccctcagtgtttgtgaaaaccacagat
gaaggagttatgcgggtgaggaaatccaaagggaagtatgcatacttgctggagtccacc
atgaacgagtatatcgagcagcgcaaaccctgcgacactatgaaggttggagggaacctg
gactccaaaggctacggtattgctacccccaaaggttcccctttaagaaacccagtaaac
ctggcagtgttaaaactgaatgaacaaggcctgttggacaaattgaaaaacaaatggtgg
tacgacaagggagagtgtggcagcggaggaggtgattccaaggacaagacgagtgctctt
agcctcagtaacgtggctggggttttctacatcctcatcggcggtctgggtctggccatg
ctggtggctctggtggagttctgctataaatccaggacagagtctcgcagaatgaagcaa
tccatcaacgacgccatgcactgctccacgctgaccaggatgagcgggaacggcagcggt
ggggagaacgggcggatcgtcacacatgacttccccaaagctgtgcagacgctgccgtgc
atgagccacgcggccagcatgggcctgggagcctctggcatgtga

DBGET integrated database retrieval system