KEGG   Danio rerio (zebrafish): 798703Help
Entry
798703            CDS       T01004                                 

Gene name
gemin7
Definition
(RefSeq) gem-associated protein 7
  KO
K13135  gem associated protein 7
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
Module
dre_M00426  Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    798703 (gemin7)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    798703 (gemin7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gemin7 SUZ-C
Motif
Other DBs
NCBI-GeneID: 798703
NCBI-ProteinID: NP_001186966
ZFIN: ZDB-GENE-120409-2
Ensembl: ENSDARG00000041011
UniProt: F1R879
Position
18
AA seq 125 aa AA seqDB search
MKTPVGVLRLPRGPEPNSRGFDPNSPRFQALCPTSLTSSSSSSSVDVEEQRLRAEQREHF
LRTLLLMTDKRVDFQLLEKLRMRGRFGASDIDVLNFQVSDLETPLGVQKEALLRCHDIIS
CSFEL
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaagactccagtcggtgttctcaggctgccaagaggaccggagccaaacagtcgaggg
tttgacccaaattctcctcgtttccaggctctctgccccacatctctgacctcctcatct
tcatcctcctctgtggacgttgaagagcagcggctgcgggcggagcagcgcgagcatttt
ctgcggactctcctcctcatgacggacaaacgcgtcgactttcagctgctggagaagctg
cgcatgcgcggtcggttcggcgcctcagacatcgatgtgctgaattttcaggtgtccgat
ctggagactccgctcggcgtgcagaaagaggctcttctcaggtgtcacgatattatttcc
tgctcgtttgaactgtaa

DBGET integrated database retrieval system