KEGG   Danio rerio (zebrafish): 798788Help
Entry
798788            CDS       T01004                                 

Gene name
gpx3
Definition
(RefSeq) glutathione peroxidase 3 precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00480  Glutathione metabolism
dre00590  Arachidonic acid metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    798788 (gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    798788 (gpx3)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     798788 (gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 798788
NCBI-ProteinID: NP_001131027
ZFIN: ZDB-GENE-070222-3
Ensembl: ENSDARG00000043342
Vega: OTTDARG00000034895
Position
14
AA seq 222 aa AA seqDB search
MGTQSNPWTSVVLLLALMHKIAALSNTQACNSAAGDSFHNYGAKTINGTQFIPFSHYAGK
HVLVVNVATYUGLTFQYVELNALHEELRHLGFTILGFPCDQFGKQEPGENNEILSALKYV
RPGNGFVPNFQLFEKGDVNGDGEQALFTFLKNACPPVGESFGATSNRLFWEPLKVNDIKW
NFEKFLLDPDGRPVMRWFPRVNVSEVRADILKYFHQLLQTAQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggggactcagagcaacccctggacctctgttgtgcttctgctggctctaatgcacaag
atagcagcactgtccaacacccaggcctgtaactcggcagctggagactcttttcacaac
tacggtgcaaaaaccataaacgggacgcagttcatcccgttctctcattacgctggaaaa
cacgtcctcgtggtcaacgtggccacctactgaggactgaccttccagtacgtggaactg
aatgcactacacgaggagcttcgccatctgggattcaccatcctcggctttccttgcgac
caattcgggaaacaagaacctggagaaaacaatgaaattctttctgcattgaagtatgtc
cgtccaggaaatggattcgttcctaatttccagttatttgagaagggagatgtgaatgga
gacggagagcaggcccttttcacattcctaaagaacgcatgtccgcctgtaggagagagt
tttggggccaccagcaacaggctgttttgggaaccgctgaaagtcaatgacatcaagtgg
aactttgagaagtttctgctggatccagatggcaggcctgtgatgcgctggttccccaga
gtcaacgtgtctgaagtcagagcagacatcctcaaatacttccatcagcttctgcagact
gcacagtaa

DBGET integrated database retrieval system