KEGG   Danio rerio (zebrafish): 799504
Entry
799504            CDS       T01004                                 

Symbol
sp5b
Name
(RefSeq) transcription factor Sp5-like
  KO
K09195  transcription factor Sp5
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    799504 (sp5b)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    799504 (sp5b)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6 zf-Di19 zf-H2C2_5 zf-LYAR zf-met DUF5810
Other DBs
NCBI-GeneID: 799504
NCBI-ProteinID: XP_005172147
ZFIN: ZDB-GENE-131231-1
Ensembl: ENSDARG00000005846
UniProt: F1Q751
Position
6
AA seq 291 aa
MHHDPLQAFLQDRTSSSTPESIKSSPLMLLEDTCNRIGRASQSMESYIPYASPNKLFHPW
RSTDSTHLSQSTFSIPPLHQDMPLTEHFDCSPLKMLPCPSSCISTCVPTHTGLVHAQRHL
ARDDIQWWSSANHSSAHFQLTRGWILGQPEFGHYQSQILLNSKSRQSRRCMCPNCQKNAD
TPGRRKQHACHIPGCAKVYGKTSHLKAHLRWHAGERPFICSWMFCGKSFTRSDELQRHLR
THTGEKRFTCPDCSKRFMRSDHLAKHLKTHLMRKNRGLFPMLDHINKTLAS
NT seq 876 nt   +upstreamnt  +downstreamnt
atgcaccatgacccactgcaggctttccttcaggatcgaacatcaagctcaactccagaa
tccatcaaatcatctcccttgatgttgctggaagacacctgtaatcgcattggccgtgca
tcccaatccatggagtcctacatcccatatgcttccccaaataaactcttccatccctgg
agaagtactgactccactcatctatcccaatcaaccttctctattcctcctttacaccag
gacatgccactgaccgaacactttgactgttcacccctgaagatgttgccttgcccatcc
tcatgtatttcaacctgcgtacccacacacaccggactcgtgcacgcgcagagacatttg
gcacgggatgacatccaatggtggagctccgccaatcactcctcggcgcattttcagctc
acacgtgggtggattttgggtcagccagagtttggccactatcagtcccaaatcctgctg
aactcaaagtcacgacaaagccggagatgcatgtgtcctaattgccagaaaaacgccgac
acgccgggcaggagaaagcagcacgcctgccacataccaggctgcgcgaaggtgtacgga
aagacatctcacctgaaggcgcacctgagatggcacgcgggggagaggcccttcatctgc
agctggatgttttgcgggaaaagtttcacgcgctcggatgagctccagcgacacctgcgc
acacacaccggggaaaagcgattcacctgcccggactgctccaagcgcttcatgcgcagt
gaccacctggccaaacacctgaagacacacctgatgaggaagaacagagggctttttccc
atgctggatcacatcaacaaaactcttgcatcttaa

DBGET integrated database retrieval system