KEGG   Danio rerio (zebrafish): 799638
Entry
799638            CDS       T01004                                 
Symbol
phospho2
Name
(RefSeq) pyridoxal phosphate phosphatase PHOSPHO2
  KO
K13248  pyridoxal phosphate phosphatase PHOSPHO2 [EC:3.1.3.74]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00750  Vitamin B6 metabolism
dre01100  Metabolic pathways
dre01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    799638 (phospho2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    799638 (phospho2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.74  pyridoxal phosphatase
     799638 (phospho2)
Protein phosphatases and associated proteins [BR:dre01009]
 HAD phosphatases
  Other HAD phosphatases
   799638 (phospho2)
SSDB
Motif
Pfam: Put_Phosphatase HAD HAD_2
Other DBs
NCBI-GeneID: 799638
NCBI-ProteinID: NP_001104699
ZFIN: ZDB-GENE-080204-104
Ensembl: ENSDARG00000102202
UniProt: A0A8M1NFI2 A9JRB9
Position
6:3710628..3713117
AA seq 241 aa
MKTLVVFDFDHTIVDENSDTWVIRCTPDQKLPDWLEKSYQRGRWTEYMGRVLTYIGDQSV
RPEHMRAVMESIPFTDGMTELLTFISENKKHIDCIIISDSNTLFIDWALQASGLKSAVDD
VFSNPANIDARGYVSLRCFHAHACKECPVNLCKRRVLRDFTENRAKDGLRYERICYIGDG
GNDFCPVKELTEGDIAMPRKGFTLEKLLRKGISEGSNELRAKIMPWTSAKEILQELRALI
E
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaagaccttagtagtgttcgacttcgatcacactatagtggatgaaaacagcgacact
tgggtgatccgctgcacccccgaccagaagttaccggactggctggagaagtcctaccag
aggggcaggtggaccgaatatatgggtcgagtgttgacctacatcggagaccagtccgtc
cggccggagcacatgcgcgcggtcatggagagcatcccgttcaccgacggcatgaccgag
ctcctgaccttcatatccgagaataagaagcacatcgactgcattatcatctccgactcg
aacactttattcatagactgggctttgcaggcgtcggggttgaaatccgcagtagatgac
gtcttcagcaaccccgcgaacatcgatgcgcgcgggtacgtgagcttgcgctgcttccac
gcgcatgcctgtaaagagtgtccggtaaacctgtgcaagagaagggtgctgcgggatttc
acggagaaccgggcgaaagatggcctgcgttatgagcggatttgctatataggagacgga
ggaaacgacttttgccctgttaaagagctgacagagggcgacattgcaatgccaaggaaa
ggattcaccctggagaaactgttgcgcaaaggcatttctgagggttcaaacgagctcagg
gccaaaattatgccctggactagtgccaaagaaatccttcaggaattaagagctctaatt
gagtga

DBGET integrated database retrieval system