KEGG   Danio rerio (zebrafish): 799650
Entry
799650            CDS       T01004                                 

Gene name
ddx21
Definition
(RefSeq) nucleolar RNA helicase 2
  KO
K16911  ATP-dependent RNA helicase DDX21 [EC:3.6.4.13]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dre03009]
    799650 (ddx21)
   03036 Chromosome and associated proteins [BR:dre03036]
    799650 (ddx21)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     799650 (ddx21)
Ribosome biogenesis [BR:dre03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    799650 (ddx21)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    799650 (ddx21)
SSDB
Motif
Pfam: DEAD Helicase_C GUCT CMS1 AAA_30 ERCC3_RAD25_C AAA_22 V_ATPase_I
Other DBs
NCBI-GeneID: 799650
NCBI-ProteinID: NP_001120807
ZFIN: ZDB-GENE-031113-10
Ensembl: ENSDARG00000063626
UniProt: A0A2R9YJN8
Position
13
AA seq 791 aa
MRTSALRTSASVLSFPHVCCESSMSSRSSTSSMPSKSLPESEAERDHLMEDIHNGLQLLK
KKKKKLKEQQQTAETDECESPAPKKRKMKISSDTTDLNGNTDTHTLKVKKKKIKLEEEEE
ETTSTLLEKKKKKKIKLEKEEMMEETNTLLEKKKKIKMEKEEEKMMNGDSHTHSTEPAAS
STDSDSEQEKETPEQREGAFSNFRISPNTIKLLQARGVSYLFDIQVKTFNAVYDGKDLIG
QARTGTGKTFSFAVPLVEKLQSGDQERRRGRPPKVLVLAPTRELAIQVTKDFKDITRKLS
VTCFYGGSSYNPQIDAIRSGIDVLVGTPGRIRDHLQNNKLDLSQLQHVVLDEVDQMLDMG
FAEQVEEILSASYKKDAEQKPQTLLFSATCPSWVYDVAKKYMRSQFIHVDLIGKKTQKAA
TTVEHLAIACHWSQRASVIGDVIQVYSGSHGRTIVFCETKKEATELSLNTSIKQSAQSLH
GDIPQKQREVTLKGFRNGSFEVLVATNVAARGLDIPEVDLVIQSSPPNDVESYIHRSGRT
GRAGRTGICICFYQRKEESQLKFVEQKAGITFKRVGVPTAYDIIQSSSKDAVRFLDSVPA
VAVGYFREAAQELIQQRGAVEALAAALAHISGATSLEQRSLINSEPGFSSMILSCSQEMH
SISFAWRGLKEQLGEEIDQHISHMVFIKGKKGVCFDVPVSKLKEVQEKWQDSRRWTLSTA
TQLPELEQSLRPNSGFGNSGGFGNRSGFGNRSGNRSGFGNRGGRGRSSGFRSSGRGGGGG
QKRSFSRAFNY
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgcgcacttccgctttgcgcacgtccgcttccgtcctttcctttcctcacgtgtgttgt
gagagctccatgtccagccgctcctcaacatccagcatgccgtcaaagagtctcccagaa
tcggaagccgagagagaccacctgatggaggacattcacaacggcctgcagctgctcaag
aagaagaagaagaagctgaaggagcagcagcagacggcagaaacagacgagtgtgagtct
cctgctcctaaaaagaggaagatgaagatttccagcgacaccacagacctgaacggaaac
acagacacacacacactcaaggtcaagaagaagaagatcaagctggaggaggaggaggag
gagacgacgagcactctgctggagaagaagaagaagaagaagatcaagctggagaaggag
gagatgatggaggagacgaacactctgctggagaagaagaagaagatcaagatggagaaa
gaggaggagaagatgatgaacggagactcacacacacactccacagagcctgcagcgtcc
agcacagactccgacagcgaacaggaaaaagagactccagagcagagagaaggagctttc
tccaacttcaggatctcaccgaacaccatcaaactgctgcaggctcgtggcgtctcgtac
ctgtttgacatccaggtgaagacgtttaatgcagtgtatgatgggaaggatctgattggt
caggcccggaccggcaccgggaagaccttctccttcgctgttcctctggtggagaagctg
cagtctggagaccaggagcggcggagaggacgaccaccaaaggttctggttctggctccg
actcgtgagctggccatacaggtgaccaaagacttcaaggacatcaccaggaaactctcc
gtcacctgcttctatggaggaagctcatacaaccctcagatcgatgcgatccgcagtggc
attgacgtcctggtggggacgccgggccgaatccgagaccatctgcagaacaataagctg
gatctgtctcagctgcagcatgtggtgctggacgaggtggaccagatgctggacatgggc
ttcgctgagcaggtggaggagatcctgtctgcctcctacaagaaagatgcggagcagaag
ccgcagacgctgctgttctccgccacgtgtccctcatgggtttatgacgtggccaagaaa
tacatgcgctcacagttcatccacgtggacctcatcgggaagaagacacagaaagctgca
accactgtcgagcacctggccatcgcatgtcactggtctcagagggcgtcggtcatcggt
gatgtcatccaggtgtacagcggcagccacggccgcaccatcgtcttctgtgagaccaag
aaggaggcgacagagctgtccctgaacacctccatcaaacagagtgctcagtctctgcat
ggagatatcccgcagaagcagagggaggtgacgctgaagggtttcaggaacggctctttc
gaggtgttggtggccactaatgtagctgcgcgcgggctggacatcccagaggtggacctg
gtcatccagagctcaccaccaaacgatgtggagtcgtatatccaccggtcgggccggacg
ggcagagctggaagaaccggcatctgcatctgcttctaccagcgcaaagaggagagccag
ctgaagtttgtggagcagaaagcggggatcacctttaagcgagtgggcgttcccacagcc
tatgacatcatccagtcctccagtaaagacgccgtcaggtttctggactcggtgccggca
gtagcggtgggatatttccgtgaggcggcgcaggagctgatccagcagcggggggcagtg
gaggctctggcagcagcactcgctcacatatcaggagccaccagcctggagcagagatcc
ctgatcaactctgagcctggtttctccagcatgatcctcagctgctcgcaggagatgcac
agcataagtttcgcctggagaggactgaaggagcagctgggagaggagatagaccagcac
atctcacacatggtcttcatcaaggggaagaagggtgtgtgtttcgacgtcccagtcagc
aaactgaaggaggtccaggagaagtggcaggacagccggcgctggacgctcagcacagcc
acacagctgccggagctggagcagagtctgcggcccaactcgggcttcgggaacagcggt
gggttcgggaacagatcaggattcgggaatcgctctgggaatcgttcaggattcggaaac
cgtggaggacgaggacgatcatccggcttcaggagctcaggacgcggtggaggaggagga
cagaaacgcagcttcagtcgggccttcaactactga

DBGET integrated database retrieval system