KEGG   Danio rerio (zebrafish): 84039Help
Entry
84039             CDS       T01004                                 

Gene name
bco1
Definition
(RefSeq) beta-carotene oxygenase 1
  KO
K00515  beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00830  Retinol metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    84039 (bco1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     84039 (bco1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 84039
NCBI-ProteinID: NP_001315424
ZFIN: ZDB-GENE-010508-1
Ensembl: ENSDARG00000104256
Vega: OTTDARG00000042985
UniProt: Q7ZTS0
Position
7
AA seq 516 aa AA seqDB search
MQYDYGKNKEEHPEPIKTEVKGSIPEWVQGTLIRNGPGMFSVGETTYNHWFDGMALLHSF
AINKGEVTYRSRYLRGDTYNSNMQANRIVVSEMGTMAYPDPCKNIFSKVITFLSHTIPDF
TDNCGNNIIKYGNDFHATSETNYIRKIDPVTLETQEKIDYLKYLPVSIVASHTHYDKEGN
SYSMGTCIAEKGKTKYMLFKVPGESRPDGSPPLKSAEAVCTLPCRSLLTPSYYHSFGMTD
NYFIFIEQPLKLDILKMATAYLRRVSWASCMKFHPEDSTLIHLIDRNTKKEVATKFYTDA
MTVYHQVNAFEDDGHVVFDVIAYDDNNLYEFFYLNKLKETMGATNLYCKPKFTRFVFPLS
DQGETGENLVKLKYTTASAVKEKDGKIMCQGEVLCEGVELPRINYNFNGKKYRYSYMCCV
DESPVATRIVKFDADTKQQIEWKGDDGFASEPVFIPRPGAVDEDDGVVLTVIINNKPLQG
GFLLVLDAKSFKEIARACLDVEIHMDMHGYFIPGSS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacgactatggcaaaaacaaggaagaacatccggagcccatcaaaactgaagta
aagggctcgattcctgaatgggtgcagggaacactaatacgcaatggacccggcatgttc
tctgttggagagacgacatacaaccattggtttgatggaatggcacttttgcacagtttt
gcaattaataaaggagaggtgacgtacaggagcagatatcttcgaggtgacacctataac
tccaacatgcaggccaatagaatagtagtctcggagatggggaccatggcgtacccggac
ccatgcaaaaacatattctccaaagtgatcaccttcctcagccacaccatcccagacttc
actgacaactgtgggaataacataatcaaatatggaaatgacttccatgctacgtctgaa
accaattatattcggaaaattgaccctgttactttagagactcaggaaaagattgactac
ctgaaataccttcctgtaagtatcgtggcttctcatacacattatgacaaagagggaaac
agctacagtatgggaacatgcatcgcggagaagggcaaaaccaaatacatgttgttcaag
gtcccaggagaaagcaggccagatggatctccacctttgaaaagcgctgaggctgtgtgc
accctgccctgccgttccctcctcacgccaagttactaccacagctttggcatgaccgac
aactacttcatcttcatcgagcaacccttgaagctggatatcctaaaaatggccacggct
tatttgaggagggtgagctgggccagctgcatgaagtttcaccctgaagacagtacactc
attcatcttattgaccgaaacacaaaaaaggaggttgcgaccaaattctacactgatgca
atgaccgtctaccatcaagtcaatgcctttgaagatgatgggcatgttgtttttgatgtg
attgcctatgatgacaacaacttgtatgaattcttttacctgaacaagctgaaggagacg
atgggagcaacaaatttgtactgcaaacccaagttcacaagatttgtgtttccccttagt
gaccagggtgagacaggtgagaatctggtcaaacttaaatacacaacagcaagtgctgtg
aaggagaaagatgggaaaataatgtgtcagggagaggttctatgtgaaggtgtggaactt
ccaagaattaattacaacttcaatggaaagaagtacagatattcatacatgtgttgtgta
gacgaatccccagtggccacaaggattgtgaagtttgatgctgacacaaagcagcagatt
gagtggaaaggagatgacggttttgcatcagagcccgttttcattcccaggcctggtgca
gttgatgaagatgatggtgtagttctgacagttatcattaataacaaacctctgcagggt
ggctttctactggtgcttgatgccaagtctttcaaagagattgcccgggcatgcttagat
gtagaaattcacatggacatgcatggatacttcataccaggcagcagctga

DBGET integrated database retrieval system