KEGG   Danio rerio (zebrafish): 450039Help
Entry
450039            CDS       T01004                                 

Gene name
chga
Definition
(RefSeq) chromogranin-A precursor
  KO
K19990  chromogranin-A
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    450039 (chga)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Others
   Others
    450039 (chga)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Granin
Motif
Other DBs
NCBI-GeneID: 450039
NCBI-ProteinID: NP_001006059
ZFIN: ZDB-GENE-041010-161
Ensembl: ENSDARG00000008829
Vega: OTTDARG00000005247
UniProt: Q5RIJ8
Position
20
AA seq 369 aa AA seqDB search
MPALRITRMIARGCVALLLLVNVVISVPVSPGHMEEKDVKVMKCIVEVIADALSKPHPIP
VSQDCLETLSTDDRLVSILRHRNFLRELQDIAAEGASERALKLPGDAPDHVTSLPKDLKK
TADDQSMLVAMEKPEKETEKRGAGEESEETEQQSQKQNQIITEEDHSKEQEEEEEKNHIS
NSLNPEPKTDSQEETTIRDEERKHSSSENEENDPAHKEEGPTATDDVEVNPDVKQSIMED
NQEHKGDETEKTHSKEEPEEDEEEKKREVGVKRWSRVSKVSHKRVEMSPKVDERWESKHS
KEREDPEGDLWRSPEEQELQLMAQTQTQDKREEEGSGSRKTGDAEIESLAAIESELESVA
QKLHDLRRG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcacttcgcatcacgagaatgatcgcgcgaggatgcgttgctctcctgctcctg
gtgaatgttgtcatctccgtgccagtttctccaggtcacatggaagagaaggatgtgaag
gtgatgaagtgtattgtggaagtgattgcagatgctctgtccaagcctcatcccatccca
gtgtcccaggactgccttgaaacgctcagcactgatgacaggctcgtgagtatcctgcgc
cacagaaactttctccgagagttgcaagacatcgcagctgaaggagccagcgagagagcg
ctgaaactcccaggagatgcgcctgatcatgtgaccagcctccctaaagacttgaagaaa
actgcagacgatcagtcaatgctggttgccatggagaaaccagaaaaagaaacagagaag
cgaggagcaggagaggagagcgaggagacagagcagcagtctcagaaacaaaaccagatt
attactgaggaagaccacagtaaggaacaagaagaagaagaagaaaagaatcacatctct
aactccttaaatccagagccgaagacagactcacaggaggagacaacgataagagatgag
gagaggaaacactccagctcagaaaatgaggaaaacgatccggctcataaagaggaaggg
ccaacagccacagatgatgttgaagtgaatcccgatgtgaaacaatccatcatggaggac
aatcaggagcacaaaggagacgaaactgagaaaacgcattcaaaagaagaaccagaagaa
gacgaggaggagaagaaaagagaggttggagtgaagcgctggagccgtgtgagtaaagtg
tcccacaagagagtggagatgagcccaaaagtagatgaacgctgggagtccaagcactcc
aaggagagagaggacccagagggggatctgtggaggagcccagaggagcaggagctgcag
ctgatggcccaaacccaaacgcaggacaaacgtgaagaagagggcagcggcagcaggaag
actggggatgctgagatcgagagtctggctgccattgagtctgaattagagagcgtggct
cagaagctccatgatctgagacgaggctga

DBGET integrated database retrieval system