KEGG   Desulfotomaculum reducens: Dred_0039
Entry
Dred_0039         CDS       T00494                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00620  Pyruvate metabolism
drm00640  Propanoate metabolism
drm00650  Butanoate metabolism
drm01100  Metabolic pathways
drm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:drm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dred_0039
   00640 Propanoate metabolism
    Dred_0039
   00650 Butanoate metabolism
    Dred_0039
Enzymes [BR:drm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Dred_0039
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABO48589
UniProt: A4J0I6
Position
complement(45889..48120)
AA seq 743 aa
MKQAWSDFLGFKWQQEINVRNFIQCNYKPYEGKSNFLCEQTPKTKQLWEKCLKLFQAERK
NNGVLSINTSRATGINTFGPGFIDRDLELIFGLQTEKPLERSVNPFGGLRMAKESCKAYG
YSLDKQLEDFFVKYKKTHNDGVFDAYTPEMRLARSLGIITGLPDAYGRGRIIGDYRRVPL
YGVDRLIEEKEKDLANMPTHTLTSQAIQLREEIREQIKSLVDLKEMARQYGFDIGSPAAN
AKEAFQWLYFAYLGAIKEQNGAAMSLGRVSTFLDIYIERDIEAGVLQETEAQELVDQFVI
KLRLARQLRTPEYDKLFAGDPMWITEAIGGMGLDGRTLVSKNSYRFLQTLINLGPAPEPN
LTILWSDRLPENFKKFSAQISIKTSSIQYENDDLMREYYGDDYGIACCVSAMKIGKQMQF
FGARANLAKLLLLAINGGQDEMTGKQLAPPIPSLDDDYLDYEKVMKNFLLLQDWLCKLYV
NTLNIIHFMHDKYAYEKIQLALHDSDVERLMAFGMAGLSVVADSLSAIKYAKVYPIRNEE
GIAVDFRIEGDFPKYGNDDDRVDDIAVALVRSFNNNLQKYTTYRNAKHTLSILTITSNVM
YGKKTGTTPDGRQKGEPFAPGATPMHGRDVNGALASLNSVAKLPYNSSLDGISNTFSIVP
AALGKTHEDREANLVNILRGYFNQQAHHLNVNVLDRTTLERAMEEPENYPQLTVRVSGYA
VHFTKLSRAHQLEVIKRTFFERF
NT seq 2232 nt   +upstreamnt  +downstreamnt
ttgaaacaagcatggtctgattttttaggatttaaatggcaacaggagatcaatgtacgt
aattttatccaatgcaattacaaaccctatgaaggaaaaagtaattttctctgtgaacaa
actccaaaaaccaaacaactatgggaaaaatgcctaaaactattccaggcagaaagaaaa
aataatggtgtgttaagtatcaataccagtcgggccacaggaattaatacctttggacca
ggttttattgaccgtgatttggaattgatttttggtttgcaaacagaaaagcctctggaa
cgttctgtgaacccctttggcggcttgcggatggccaaggaatcctgtaaagcctatggt
tactccttagacaaacagttagaagatttttttgttaaatataaaaagacgcataacgat
ggggtttttgatgcctatactccagaaatgcgtctggctagaagtcttggcattattact
ggtctgccagatgcctatggacgtggcagaatcatcggggattaccggcgggttcctcta
tacggagttgatcgcttaattgaagaaaaagaaaaggatctggctaatatgccaacacac
acccttacttcccaagccattcaactccgggaagaaattagggagcagattaaatcccta
gttgatttaaaagagatggccagacaatatggttttgacatcggttctccggcggccaat
gcaaaggaagcctttcaatggctatactttgcttatcttggtgccattaaagaacaaaac
ggtgccgccatgtctttgggccgagtcagtacgtttttagatatctacattgagagagac
attgaggcgggagttttgcaagaaacagaggcccaggaattggttgaccagtttgttatt
aaacttcgcttagccagacaattgagaactccggaatatgataaattgttcgccggggat
cctatgtggattactgaagccattggtggcatgggcttagatggcagaaccttggtttca
aaaaattcctatcgttttctacaaactttaatcaatctgggacctgcgccagaacctaac
ttaacaattctttggtcagaccgtttgccggagaattttaaaaaattcagtgcccaaata
tctattaaaaccagttccattcaatatgaaaatgatgacttaatgagagagtattacggt
gatgattatggcattgcctgctgtgtttctgccatgaaaataggcaaacaaatgcagttc
tttggggccagggctaatttagcaaaactgttgttattagctatcaacggtggccaagac
gaaatgacaggtaaacaactggcaccgcccattccttccttggatgatgactatctggat
tacgagaaggttatgaaaaactttctactgttacaggattggctgtgcaaattgtatgta
aataccctgaacattattcactttatgcatgataaatatgcctacgaaaaaatccaactg
gccttgcatgatagcgacgtagaaagactgatggcctttggtatggcaggattgtcggtg
gttgcagactcccttagcgccattaaatatgctaaggtgtaccctatccgaaatgaagaa
ggaattgctgtggattttaggattgagggggattttcctaaatacggcaatgatgacgat
cgggtggatgatattgcggtggcactggtacgtagttttaataataatttgcaaaaatac
acaacttaccgcaacgccaaacatacactatccatcttaaccattacctccaatgttatg
tatggtaaaaaaaccggtactacgccggatgggcggcaaaagggtgagccctttgcaccg
ggagctactcccatgcacggcagggatgtgaacggcgccttggcaagccttaattctgtg
gcaaaacttccctacaattcatctcttgacggtattagcaataccttctccattgttccc
gctgccctggggaaaacccatgaagacagggaagctaacctagtcaacattttaaggggt
tattttaatcaacaagcccatcatttaaatgtcaatgttctggatcgtaccacattggaa
agggcgatggaagaaccggaaaactatccacaattaacagtccgagtttccggctatgcc
gttcactttaccaagttaagcagagctcatcagctggaagttattaaaaggacttttttt
gaaagattttaa

DBGET integrated database retrieval system