KEGG   Desulfotomaculum reducens: Dred_0094Help
Entry
Dred_0094         CDS       T00494                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00900  Terpenoid backbone biosynthesis
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01130  Biosynthesis of antibiotics
Module
drm_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dred_0094
Enzymes [BR:drm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Dred_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABO48644
UniProt: A4J0P1
Position
100737..101585
Genome map
AA seq 282 aa AA seqDB search
MGIRLKAHGKINLTLDVLDRRPDGYHEVEMIMQSISLHDVLEIEEQSKEISLTVSGISVT
AEEDNLVLKAARLLQQVAGTGAGAKIHLQKNIPVAAGLAGGSTDAAATLKGLNALWGLGL
SQEQLRQLATQLGADVPFCLAGGTAIARGIGEKLTTLEPAPPFGIILVKPSFGVSTAEVY
QGLRLEHLGKRPNTEAMVKALKERDLGQVARELANVLESVTLRMHPKLEQIKEILRQIGC
TGVLMSGSGPTVFGLTENREKAAELISGLPQAGCHVLAAWMV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcaggcttaaggcacatggcaaaatcaatttgacactggatgtcctagaccgg
cgtcccgatgggtatcacgaagtggaaatgatcatgcagagcattagcttgcatgatgtt
ctagaaatagaggaacaaagtaaagagattagcctcaccgtttcgggcatttctgtaacg
gctgaagaagataatctggtcttaaaggcagcccgcctactgcaacaagtggcaggtacg
ggtgctggggcaaaaatacatctacaaaaaaacataccagtggctgcgggcttggcaggt
gggtctaccgatgcagctgcaacactcaaaggacttaatgcgttatggggactgggacta
agccaggaacagcttagacagttggctacacaactaggcgcagacgtacccttttgtctg
gcagggggaaccgccattgcccgagggattggagaaaagcttacgaccttagagccggcg
ccaccctttgggattatcttagtaaaaccttcctttggcgttagtacagcggaagtgtac
cagggactgaggctggagcatttagggaaaaggccgaatactgaggccatggtaaaggcg
ctcaaagaaagggaccttggtcaagtggcccgggagttagcaaatgttttagaaagtgta
accctaagaatgcatcccaaacttgagcaaataaaggaaatcctacgacagattggctgc
acaggtgtattaatgtccggcagtgggcccactgtttttggtttaacagaaaacagagag
aaagccgcagagctgatatctgggctaccccaagcaggctgtcatgtattggccgcatgg
atggtttga

DBGET integrated database retrieval system