KEGG   Desulfotomaculum reducens: Dred_0105Help
Entry
Dred_0105         CDS       T00494                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00260  Glycine, serine and threonine metabolism
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01120  Microbial metabolism in diverse environments
drm01130  Biosynthesis of antibiotics
drm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:drm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dred_0105
Enzymes [BR:drm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Dred_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABO48655
UniProt: A4J0Q2
Position
complement(110962..111996)
Genome map
AA seq 344 aa AA seqDB search
MITIRVVDLRSDTITLPTDEMRKAMATAVVGDDVYKEDPTVNQLEETAASLLGKEAALFV
PSGTMGNQIAVLTHTARGEEVLLDSEAHIYYYEVGGPAMLAGVQLRPVSDLLTDHGPEIL
KGSLRGEDLHFPHTSLICLENTFNRGGGTILSPHTMGRIYSIAQEHNLKVHVDGARIFNA
AVSLGVDVRTFSQHCDSLMFCLSKGLAAPVGSLLVGTRQFIERARKYRKALGGGMRQAGI
LAAAGLVALQNVDRLAEDHANARRLAEGLAKLPGLGVDLAKVQTNIIVVNVNQPRSAADL
TMALNNKGIKCSTFGPSTIRMVTHINVSKEDIDYALGIAKYLLQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgattaccattcgagtggtagatttacgcagtgacaccatcactttgcccactgacgaa
atgagaaaggccatggctaccgcggtggttggtgacgatgtatacaaagaagaccctacg
gtaaaccagttggaagaaactgccgcttctttgcttggaaaagaagcagctctttttgtt
ccttctggaaccatgggtaaccaaatagcagttttaacccatactgcccggggtgaagag
gtccttctggacagcgaagcccatatttattactacgaagtgggcggtcctgccatgctg
gccggggtgcaattaagaccggtcagtgatttattaacagaccatggcccggaaatttta
aagggttccttgcggggagaagatctccattttcctcatacgtcattaatttgtttagaa
aatacctttaatcgtggtggcggcaccatcctctctccacacaccatggggaggatttac
tcaattgcccaggaacataacctaaaggtccacgtggacggtgcccgtatttttaatgca
gccgtatccctcggggtagatgttcggacttttagtcagcattgtgattccctcatgttc
tgtctttcaaagggcttggctgcaccagtgggttctttgctggttggtacacggcagttt
atcgaacgagcaagaaaatatcgcaaggctctggggggcggcatgcgtcaagccggtatt
ctggctgccgctggtttagttgctttgcagaatgtggacaggcttgcagaagatcatgcc
aacgcccggcggttggccgaaggtctggctaaattaccgggactaggtgttgatttggct
aaagtacaaaccaatatcatcgttgtaaatgtaaatcagccgcgctctgcagcagattta
accatggcactaaataataaagggattaaatgttccacctttggtccctccaccatccgc
atggttactcatataaatgtttctaaagaggatatagactatgccttaggcattgctaaa
tatctcttgcaataa

DBGET integrated database retrieval system