KEGG   Desulfotomaculum reducens: Dred_0354Help
Entry
Dred_0354         CDS       T00494                                 

Definition
(GenBank) OmpA/MotB domain protein
  KO
K02557  chemotaxis protein MotB
Organism
drm  Desulfotomaculum reducens
Pathway
drm02030  Bacterial chemotaxis
drm02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:drm00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Dred_0354
   02040 Flagellar assembly
    Dred_0354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:drm02000]
    Dred_0354
   02035 Bacterial motility proteins [BR:drm02035]
    Dred_0354
Transporters [BR:drm02000]
 Other transporters
  Pores ion channels [TC:1]
   Dred_0354
Bacterial motility proteins [BR:drm02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    Dred_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotB_plug OmpA DUF4735 YabA
Motif
Other DBs
NCBI-ProteinID: ABO48902
UniProt: A4J1E9
Position
complement(373904..374614)
Genome map
AA seq 236 aa AA seqDB search
MAKHREQHEEHIDESWLIPYADLLTLLLALFIVLFASSTIDNQKFNAMKESLNAALNSGA
GIMESKSLSDQLIDKTEVKTDTVVELQELKKQLDQYIKENNMTTEVETNIINNHLTLTIR
DRALFDSGSAVVKPQSRKIIKAMGSILQQYPKFEVLVAGHTDNQPIYNNTFESNWDLSSK
RALNCMKIMLTNKNLDPRRLVAIGYGEYRPIAENTTTEGRAKNRRVEVIINQKVIQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcacagagagcagcatgaggaacatattgatgaatcctggctaatcccctat
gctgatttgttaacccttttattagctttgtttatagtcctttttgcttccagcaccatt
gataatcaaaaatttaacgccatgaaggaatcactgaatgctgctttaaacagtggggca
ggcatcatggaatccaaatccttgtctgatcagttgattgataaaacagaggtgaaaacc
gatactgtcgtggaactgcaggaattaaagaagcagttagatcagtatataaaggaaaat
aacatgacaacagaggtggaaactaatattatcaacaaccacctaactctcaccatccgg
gaccgcgctttgtttgattccggcagcgccgttgtaaaaccccaatccagaaagattatt
aaagcaatgggtagtatccttcaacagtaccccaaatttgaggtgctggtagccggtcat
acagataatcagcccatttacaacaacacctttgaatccaactgggatcttagttccaaa
cgcgccctaaactgcatgaagatcatgctgaccaataaaaacctagacccacgccgcttg
gttgccatcggttacggtgaatatcgacccattgctgagaacacaaccaccgagggccgt
gccaaaaaccgccgggtagaagttattatcaatcaaaaggtcattcaataa

DBGET integrated database retrieval system