KEGG   Desulfotomaculum reducens: Dred_1892Help
Entry
Dred_1892         CDS       T00494                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00071  Fatty acid degradation
drm00280  Valine, leucine and isoleucine degradation
drm00310  Lysine degradation
drm00362  Benzoate degradation
drm00380  Tryptophan metabolism
drm00620  Pyruvate metabolism
drm00630  Glyoxylate and dicarboxylate metabolism
drm00640  Propanoate metabolism
drm00650  Butanoate metabolism
drm00720  Carbon fixation pathways in prokaryotes
drm00900  Terpenoid backbone biosynthesis
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01120  Microbial metabolism in diverse environments
drm01130  Biosynthesis of antibiotics
drm01200  Carbon metabolism
drm01212  Fatty acid metabolism
drm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dred_1892
   00630 Glyoxylate and dicarboxylate metabolism
    Dred_1892
   00640 Propanoate metabolism
    Dred_1892
   00650 Butanoate metabolism
    Dred_1892
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dred_1892
  Lipid metabolism
   00071 Fatty acid degradation
    Dred_1892
   00072 Synthesis and degradation of ketone bodies
    Dred_1892
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dred_1892
   00310 Lysine degradation
    Dred_1892
   00380 Tryptophan metabolism
    Dred_1892
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dred_1892
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dred_1892
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dred_1892
Enzymes [BR:drm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dred_1892
Exosome [BR:drm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dred_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABO50414
UniProt: A4J5R1
Position
complement(2080037..2081161)
Genome map
AA seq 374 aa AA seqDB search
MGVDITVGKEAIKRAGIDPSMVDEITLGQVYPHMQGSLPARWVGMACGLDVKSSAVNVNQ
NCTSGMRALEIAAHNIMLGNTDIALVVGTESMTNVPYLLPNARMGYRMNAQTVEDGLIRD
ALFCPFTGAHMAITAENVAEKYGITRDECDQLALISHQRASKAVEEGTFKREVVPVELKG
KKGQVTYFEKDEHLIADANLEAMSKLPPVFKKGGTVTAANASGINDGAAATILMSKEKAR
ELGIKPLLRLVNICSEGIEPTVMGLGPAVAIPKVLKKANLNFEDIEYWEINEAFAAQFLG
VGRMLKEDYGMELTLDKVNHNGSGIALGHPVGCTGLRLIVSLYYEMERLGLTLGGASLCV
GDGPAMASLWSREI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggagttgatattactgtagggaaggaagccatcaagcgggcaggaattgatccatcc
atggttgatgaaattaccctggggcaggtttatcctcatatgcaaggctcgttgccagca
cgatgggtaggaatggcctgcggactagatgttaagagtagtgcagttaatgttaaccaa
aattgtacctctggtatgcgggcccttgaaattgccgctcataatatcatgcttggtaat
acagacattgctttggtggtaggtacagaaagtatgaccaacgttccttatttgctccca
aatgcaaggatgggttacaggatgaatgcacaaactgttgaggatggcctgattcgtgat
gctttattctgcccttttacgggtgctcatatggccataaccgcagaaaatgttgccgaa
aaatatggaattacccgcgatgaatgtgaccaactggcccttattagtcaccaacgtgcc
agcaaagcagttgaagagggaacttttaaacgagaggtagtgccggtagagcttaaagga
aaaaaaggacaggtaacttattttgaaaaagatgagcatttaatagctgatgccaatctt
gaagcaatgagtaaattacccccggtttttaaaaaaggaggaacagttaccgccgccaat
gcttctggtatcaatgatggagcagcagcaactatcctaatgtctaaggagaaagcaagg
gaattgggtatcaagccgcttttaagattagtcaacatttgcagtgagggaatagaacct
acagtaatgggattgggtccagcagtggctattcctaaagtccttaaaaaggctaacctg
aactttgaagatatagagtattgggaaattaacgaggcctttgctgctcagttcttgggg
gtaggcaggatgctaaaagaagattatggcatggaattaacattggataaagtcaaccat
aatggctctggaatcgctctgggacacccggttggatgtaccggtctacgtctaatagta
tctttatactatgaaatggaacgcctgggactgactctgggtggagcttccctgtgtgtt
ggagatggaccagcgatggcttccctatggagcagagaaatatag

DBGET integrated database retrieval system