KEGG   Desulfotomaculum reducens: Dred_2043
Entry
Dred_2043         CDS       T00494                                 

Definition
(GenBank) NADH dehydrogenase subunit D
  KO
K00333  NADH-quinone oxidoreductase subunit D [EC:7.1.1.2]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00190  Oxidative phosphorylation
drm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dred_2043
Enzymes [BR:drm01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Dred_2043
SSDB
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Other DBs
NCBI-ProteinID: ABO50560
UniProt: A4J657
Position
complement(2242941..2244041)
AA seq 366 aa
MTIKTEEFLLNLGPQHPSTHGVFRIVLTLDGETVVKAVPVPGYLHRGIEKLLESRTYTQV
IPYTDRLDYLAGMLMNWGYVHAVEKLMEVEIPERAEYIRVIVGELSRIASHLVATGAYAA
DIGGLTGFIYTFRDREEIMDLFEMISGARLTPSFMRIGGVAYDIPDGFMERCKKFVDYLP
EAIKEYNTLITGNEIFQARTKNVAILSAEKAIDMSLSGPVLRATGVNYDLRKVRPYSVYE
RFEFEVPLGTKGDCFDRYYIRLLEMEQSARIIQQAMDQIPEGPIRAKIPKMIKPPVGEAY
AEIESSKGIMGTYVVSDGSTKPYRVHFRRPSFVNLGYLNEMLRGWKIADVIAILGSIDIV
LGEVDA
NT seq 1101 nt   +upstreamnt  +downstreamnt
ttgaccattaaaaccgaagaatttttattaaatttaggtccgcagcatcccagtacccac
ggtgtttttagaattgttttaaccctggatggtgagactgtagtaaaggctgtaccggtt
ccgggatatctgcacaggggtattgaaaaattacttgagtccagaacctatactcaagtt
attccctatacagatcgtcttgattacttggcaggtatgttaatgaactggggctatgta
catgctgttgaaaagctaatggaggttgaaataccggaaagggctgaatatattcgggtt
attgttggggaattatcccgaattgccagccacctggtggccaccggtgcctacgcagcg
gatattggaggactgacaggctttatttacactttccgggatcgtgaagaaattatggac
ctgtttgaaatgatctccggtgccaggctaactccaagttttatgcggataggtggtgta
gcctatgatattcctgatggttttatggagcggtgcaaaaagtttgtagattacctgcct
gaggccattaaagaatataacaccctaattaccggaaatgaaatctttcaagccaggaca
aagaatgttgccatcttatcggcggaaaaggccattgatatgagtctgtcgggtccggtc
ctgagggctactggtgttaattatgatcttaggaaggttaggccctacagtgtgtacgag
agatttgagtttgaggttcccctcggtactaagggtgactgctttgatcggtattatatt
cgcttattagaaatggaacagtcagcgaggattattcaacaggccatggatcaaataccc
gaaggacccataagggcaaaaataccaaagatgataaaacctcctgtgggagaagcctat
gcagagattgaaagttctaaagggattatgggtacctatgttgttagtgacggcagtacc
aaaccttatcgggtacacttccgccgcccatcctttgtaaacttgggttatttaaatgaa
atgctacggggctggaagatagcggatgttattgccattcttggcagcattgatatcgtg
ttaggtgaagttgatgcttag

DBGET integrated database retrieval system