KEGG   Desulfotomaculum reducens: Dred_2156Help
Entry
Dred_2156         CDS       T00494                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00860  Porphyrin and chlorophyll metabolism
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:drm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dred_2156
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:drm01007]
    Dred_2156
Enzymes [BR:drm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Dred_2156
Amino acid related enzymes [BR:drm01007]
 Aminotransferase (transaminase)
  Class III
   Dred_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Glyco_tranf_2_3
Motif
Other DBs
NCBI-ProteinID: ABO50673
UniProt: A4J6H0
Position
complement(2360245..2361543)
Genome map
AA seq 432 aa AA seqDB search
MAPSYQKSEEMFEQAQRIIPGGVNSPVRAFKSVGMNPPFIARANGSRMWDVDGNEYIDYI
CSWGPQILGHRHPAVIHALQDCLEKGTTYGAPTDLEVTLAQMLTEALPSVEMVRMVNSGT
EATMSALRLARAYTNRSKIIKFEGCYHGHHDSLLIKAGSGALTHGVPTSPGVPENIASNT
INARYNDLELLEKIFTEVGSDIAAIIVEPLAGNMGVVPPAEGFLQGLRDLCNKHSALLIF
DEVITGFRLSYGGAQAYYNVMPDLTCLGKIIGGGLPVGAYGGRREIMQMVSPAGPVYQAG
TLSGNPLAMTAGIATLKQLQQPGVYEELDYKSDLLAQGLIQAAKAAGVEASFNRVQSLQT
CFFTQQDVRDFATASSSDTKQYAAFFRNMLEQGIYLAPAQFEATFVSLAHTENDIERTVE
AAFNAFRAAAKE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagctaccaaaaatcagaggaaatgtttgaacaagcccaaaggattatccct
ggcggtgtaaacagccccgtacgagcctttaaatccgtagggatgaacccacccttcatt
gctagggctaatggttcccgtatgtgggacgtggatggcaatgaatatatcgactatatt
tgttcctggggaccgcagattctaggacatcgtcaccctgcggtgattcacgcccttcaa
gactgcttagagaaaggaaccacctatggggctcctacggatctggaggtaaccctggct
caaatgttgacagaggcattaccatcggtggaaatggttcgcatggtgaactctggtaca
gaggcaaccatgagtgccctgcgcttagcccgagcctatacaaatcgaagcaaaattata
aaatttgaaggctgttaccatggccaccatgattcccttttgattaaagccggttcagga
gcccttacccatggtgttcccaccagcccaggggtgccagaaaacattgccagcaataca
attaatgcacgttataatgatctggaattgttggagaagatctttactgaagtgggttcg
gatatagcagctattattgtggaacccttagcaggaaatatgggggttgttcctccagca
gagggttttctgcagggactaagggacctttgtaacaaacatagtgccctgttaattttt
gatgaagttattacaggtttccgcttaagttatgggggtgctcaggcctattataatgtt
atgcctgatttaacctgcctgggtaaaatcataggtggcgggttacctgtgggggcatac
ggtggccgcagggagattatgcagatggtttctcctgcgggtccggtgtaccaggcagga
acgctttccggcaatcctttggcgatgactgcgggtatcgcaacccttaagcaattacag
caaccgggtgtttatgaagagcttgattacaagtcagacctcctggcccagggtttgatt
caagctgcgaaagcggctggtgtggaggcatcctttaaccgggtacaatccttgcaaacc
tgtttcttcacccagcaggatgtaagggacttcgccacagcttcctcctctgataccaag
cagtatgcagccttctttagaaacatgttggagcagggtatttacctggcacctgcacag
tttgaagcaacctttgtttcattggcccatactgagaatgatatagagcgtacagtggaa
gcggcctttaacgcctttagggctgctgcaaaggaataa

DBGET integrated database retrieval system