KEGG   Desulfotomaculum reducens: Dred_2273Help
Entry
Dred_2273         CDS       T00494                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00030  Pentose phosphate pathway
drm01100  Metabolic pathways
drm01120  Microbial metabolism in diverse environments
drm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dred_2273
Enzymes [BR:drm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Dred_2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N Proteasome
Motif
Other DBs
NCBI-ProteinID: ABO50783
UniProt: A4J6T0
Position
complement(2483348..2485075)
Genome map
AA seq 575 aa AA seqDB search
MTKLFRVNMTTKEAKIEELPQKYVGLAGRALTSSFVLDEVEPKCHPLGPNNKLIFAPGLL
GGTNCANSGRLSVGSKSPLTGGIKESNSGGTAAQKLAKMGIAGVIVEGMPADDKFYVIKV
TVDGAVLEEAPAEIMGKGNYEAIRVLSEKYGAKVGIMIIGPAGEMKLTSANISVKDPEGN
IRSAGRGGLGAVMGSKKVKAIVIDDTGAKGVPIANPEAFKAAAKRFAKGLIEHPVTGQGL
PGFGTNVLVNILNEAGGLPTKNFRAGRNEWANNISGETMSATIEARGGKVSHGCHAGCVI
RCSQHYHDKEGKYLTSGFEYETIWALGANACINDLDVIAECDRLMDDIGVDSIETSVTIG
VAMEAGIIPWGDATAAVDLVKQIGQGTPLGRIIGSGAAFTGQAFGVTRVPVVKKQAIPAY
DPRAVKGVGLTYATTPMGADHTAGYAVATNILKVGGFVDPLEKGGQVELSRNLQIATAAV
DSTGLCLFVAFCILDNADAFQAIIDMLNAQYSLALTADDVTELGKTVLRAERKFNELAGF
TKADDRLPEFFKEECPPHNTTWDFTEEEVDEVFNF
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaactttttcgtgtgaacatgacaaccaaagaagccaagattgaagagcttccc
cagaagtatgttgggctcgctggccgtgccttgacctcaagctttgtacttgatgaggta
gaacctaaatgccatcccctgggacccaacaacaaactaatttttgcgcctggtctgctg
ggaggtaccaattgtgctaactccggacgtctttccgtaggaagtaagagtcctttaacc
ggtggtattaaagaaagtaactccggtggaaccgctgctcagaagttagcaaaaatgggc
attgcaggtgtcatagttgaaggaatgcctgccgatgataagttttatgtaattaaagta
accgtagatggtgcggttcttgaagaagcgccagcggaaattatggggaaaggcaactat
gaggccatccgggttctgagtgaaaaatatggtgctaaagtcggtatcatgatcattggc
cctgccggtgaaatgaaactgacatctgctaacatttcggtaaaagatcccgaaggcaat
atccgtagtgctggtcgtggtggcttaggtgctgttatgggctccaagaaagttaaggcc
atcgttatcgatgatactggagccaagggagtgcccattgccaatcctgaagcctttaag
gctgctgccaaacgttttgctaaaggcttaattgagcaccctgtaactggccaaggtctg
cctggttttggtactaacgtgctggttaacatcctgaacgaagccggtggtctacccacc
aaaaacttccgtgctggtcgcaatgaatgggctaacaacatcagtggcgaaaccatgagt
gctaccattgaagcccgtggcggtaaagtttcccacggttgccatgctggttgtgtcatt
cgctgttctcagcactaccatgataaagaaggtaaatatctcaccagtggctttgaatat
gaaaccatctgggccctgggcgccaatgcttgcattaacgatctggatgtcattgccgaa
tgcgatcgcctgatggatgatatcggtgtagacagcattgaaacttccgtaactattggt
gtagctatggaagctggcatcattccttggggcgatgcaactgctgcagtcgatttggtt
aaacaaatcggtcaaggaacccctctaggccgtatcatcggtagtggtgctgcctttacc
ggtcaagcctttggtgtaaccagagttcccgttgttaagaaacaagccattcctgcttat
gatccccgtgctgtaaagggcgttggcttaacctatgccaccactcccatgggcgccgac
cacactgcaggttatgctgtggctaccaacattcttaaagtgggtggttttgttgatccg
ttggaaaaaggtggtcaggtagaactttcccgcaacttacagatagccactgcagcagtt
gacagtactggtctctgcctctttgtagccttctgtatcctggataacgcagatgccttc
caggctattatcgatatgctcaacgctcaatacagtctagctttaactgctgacgatgtt
actgaactaggtaaaaccgttctacgggcagaacgtaagtttaatgagttggctggtttc
accaaagccgatgatcggttaccagaattcttcaaagaagaatgtcctcctcacaacacc
acctgggacttcactgaagaagaagtggacgaagtatttaacttctag

DBGET integrated database retrieval system