KEGG   Desulfotomaculum reducens: Dred_2315Help
Entry
Dred_2315         CDS       T00494                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00061  Fatty acid biosynthesis
drm00620  Pyruvate metabolism
drm00640  Propanoate metabolism
drm00720  Carbon fixation pathways in prokaryotes
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01120  Microbial metabolism in diverse environments
drm01130  Biosynthesis of antibiotics
drm01200  Carbon metabolism
drm01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dred_2315
   00640 Propanoate metabolism
    Dred_2315
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dred_2315
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dred_2315
Enzymes [BR:drm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Dred_2315
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Dred_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zinc_ribbon_5 IBR Clc-like
Motif
Other DBs
NCBI-ProteinID: ABO50825
UniProt: A4J6X2
Position
complement(2533084..2533950)
Genome map
AA seq 288 aa AA seqDB search
MVLEIFRKPKYVTVRPEKTETTQGNERRDIPEGLWVKCSRCNEILYTKELDKNFKVCHKC
NFHFRLNAQERIHMTLDEGSFQERDNELITLNPLNFPDYQEKIQSAQKATELKEAVVTGE
GTIGGNPVVIGVMDSHFIMGSMGSVVGEKIARAIERAIEKKLPVVLFSTSGGARMQEGIL
SLMQMAKTAAALAKLDEAGLLYVAVLTDPTTGGVTASFASLGDIIIAEPGALIGFTGPRV
IEQTIRQKLPEGFQRAEFLRKHGMVDMIVNRPQLKDTLANILSLHGTN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttggtcctagaaatatttcgcaaacctaaatatgtaactgtacgtcccgaaaaaacagaa
acgactcaaggcaacgaaagaagagacattccagaaggtttatgggtaaaatgttctcgc
tgcaatgaaattctttatacaaaggaattggataaaaattttaaggtatgtcataagtgc
aattttcattttaggttaaatgcgcaagagcgtattcatatgaccctagatgaaggttct
tttcaggaacgtgacaatgagttaattacattgaatccattgaattttccagattatcag
gaaaaaatacagtctgctcaaaaagcaactgaattgaaggaagccgtagtaaccggcgaa
ggtaccataggcggaaatcctgtggtcattggtgttatggactcgcattttattatgggt
agtatgggatctgtggttggagaaaaaattgcccgtgccattgaaagagccattgaaaag
aaattaccggtggttctgttttctacttccggtggtgccaggatgcaggagggaatttta
tctcttatgcaaatggcaaaaactgctgcagctttggctaaattagatgaagcgggatta
ttgtatgttgctgtccttactgaccccacaaccggcggagtaacagccagctttgcctct
ctgggagatattattatagcagaacccggagctttaattggttttaccggccctagggtt
attgagcaaaccattcggcaaaagttacccgagggcttccaaagggctgagtttttgcga
aagcatggtatggtcgatatgattgtgaatcgtccacagcttaaagataccctggctaac
attctttcacttcatgggacgaattaa

DBGET integrated database retrieval system