KEGG   Desulfotomaculum reducens: Dred_2559Help
Entry
Dred_2559         CDS       T00494                                 

Definition
(GenBank) ATP-dependent proteinase, Serine peptidase, MEROPS family S16
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
drm  Desulfotomaculum reducens
Brite
KEGG Orthology (KO) [BR:drm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:drm01002]
    Dred_2559
Enzymes [BR:drm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     Dred_2559
Peptidases and inhibitors [BR:drm01002]
 Serine peptidases
  Family S16: lon protease family
   Dred_2559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lon_C LON_substr_bdg AAA AAA_5 ChlI AAA_2 AAA_22 AAA_16 AAA_PrkA AAA_3 RsgA_GTPase AAA_18 Birna_VP4 AAA_33 AAA_14 RuvB_N TsaE NACHT RNA_helicase IstB_IS21 SKI NTPase_1
Motif
Other DBs
NCBI-ProteinID: ABO51069
UniProt: A4J7L6
Position
complement(2784808..2787240)
Genome map
AA seq 810 aa AA seqDB search
MNSEIKSLPLLPLRGILVFPYMVIHLDVGREKSIQAIEEAMVQDRMIFLATQREAQTDEP
TVDDIYNIGTVAEVKQLLKLPGGTIRVLVEGIARAKIEKYEHQDPYFRVEVQQYSEEFEK
GAEVEALMRSLVYQFEQYVKLSKRIPPETVVSVVNLEEPGRLADIIASHLALKIEDKQNV
LESVEIVDRLEKLCGIVAKELEIVELERKINIRVRKQMEKTQKEYYLREQMKAIQKELGE
KDERVAECEEFREKISKAKFPKEAEEKALKEVERLEKMPPMAAEAAVVRNYLDWMLSLPW
SKSTKDRIDINAAEEVLEADHYGLKDPKERITEYLAIRKLAKKMKGPILCLVGPPGVGKT
SLGRSVARALDRKFVRISLGGVRDEAEIRGHRRTYVGAMPGRVIQGMRTAGSKNPVFLLD
EIDKMASDFRGDPSSALLEVLDPEQNSTFSDHYIETPFDLSNVMFITTANNMYSIPRPLL
DRMEVIQISGYTEEEKLQIAKRHLMPKQIKDHGLTEEMIQISENTILKVIREYTRESGVR
NLERKIASICRKTAKKIVAGQAEKVKVTTQNLEQFLGIPRYRYGVAEQNDEVGTVTGMAW
TEVGGDTLVIEVTTYKGTGRMTLTGKLGDVMKESAQAGYSFIRSRAQELGIDQEMFEKWD
LHIHIPEGAIPKDGPSAGITMATAMASVLTGRKVRHDIAMTGEITLRGRVLPVGGIKEKV
MAAHRAGIKLIILPNDNKKDLEDIPVNIKKQLEFKLVDHIDQVLAIALLEKEVVDTTTVL
EPEAAVMDNPHFSAVDSQEVQQQGGTQLPS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
gtgaattccgaaattaaatctttacccctgctcccattacggggtattttggtatttcct
tatatggtcatacacctagacgttggaagagaaaaatcaattcaagccatagaagaagca
atggttcaggatagaatgattttcctagcaactcaaagagaggctcagaccgatgagccc
acagtggatgacatttataatattggaacagtggcagaagtaaagcaactgttaaaactt
ccgggtggcacaattagagtgctggtggaaggcattgctcgggccaaaattgaaaaatat
gaacatcaagatccttattttagagtagaagttcagcagtattcggaagaatttgagaaa
ggtgcagaagtagaagctctaatgaggagtttggtctatcaatttgagcaatatgtaaaa
ctttctaaaagaattcctccagaaacggtggtctctgtagtaaatttagaagaacctggc
cgtctggctgatattattgcctctcatttggccctaaaaattgaagataagcaaaacgtg
cttgaatctgttgagatagtagatcgcttggaaaaactttgtggtatcgtggctaaagag
ttggaaattgttgaattagagcgtaagatcaacattcgagttcgcaagcaaatggaaaaa
acacaaaaagagtactatttaagggaacaaatgaaagccatccaaaaagaattaggtgaa
aaggatgagcgggtggctgaatgcgaagaatttagagagaaaatttctaaggctaagttc
ccaaaagaagctgaagaaaaggctttaaaggaagtggagcgcctggaaaaaatgccccca
atggcagcggaggcagctgttgtacgcaactatctcgattggatgttaagtttgccttgg
agcaagagtactaaagaccgcattgatatcaatgcggcggaagaagttttagaagccgac
cactacggattaaaggatcccaaagaaagaatcaccgaatatttagctattcgtaaattg
gccaagaaaatgaaaggtcctatactctgcttagttgggcctccaggtgttggtaaaacc
tccctagggcgttctgttgccagggccctagatcgcaagtttgtaaggatttccttggga
ggtgtacgggacgaggcagaaatacgtggtcaccgtagaacctatgtaggggctatgccc
ggacgggttatccaaggaatgagaaccgccgggtctaagaatccggtattcctactggat
gaaattgataaaatggccagcgatttcagaggagacccgtcttctgcgttgctggaagta
ctggatcctgagcaaaatagtaccttcagtgaccattacatcgaaacaccctttgatctg
tccaatgttatgtttattaccacagctaacaatatgtattccattccccggcccttgctg
gatcgcatggaagttattcaaatttctgggtatactgaagaagagaaactacaaatagct
aagcgtcacctgatgcctaaacaaattaaagaccatgggctgaccgaagaaatgatccag
atttccgaaaataccattctgaaagtgattcgggagtatactcgggaatccggggtaagg
aatttggagcgcaagattgcatccatctgccgtaaaactgccaaaaaaattgtggctggg
caagcggaaaaagtgaaggttactacccagaatctggaacagttcttaggaattccccgt
tatcgttacggagtagcggagcaaaatgatgaagtgggtacagtgactggcatggcctgg
accgaagtgggtggtgataccctggtcatcgaagtaaccacctataaaggaaccggtcgt
atgacccttacaggtaaactgggcgatgtcatgaaagaatctgcccaggctggctatagc
tttattcgcagccgtgcccaggaacttggtattgatcaggaaatgtttgagaagtgggat
ttgcatattcatatccccgaaggggctattcccaaggacggtccctctgccggtataaca
atggctacagcgatggcttcggtgcttacgggacgtaaggtgcgacatgatattgctatg
accggtgaaattaccctgcgtggtcgcgtcttgcccgtaggtggaattaaagagaaggtc
atggcagcccaccgggcaggtattaaattgatcattctgcccaacgataacaaaaaagac
ttggaggatatcccagtcaacattaaaaagcagctagaatttaagctggtggatcacatc
gatcaggtgttggccattgccctgctggaaaaagaagtggtagacacgaccacagtttta
gaaccagaagcagcagtaatggataatccgcacttttcggcggtggattcccaggaggtt
cagcagcaaggaggaacccagttaccgtcgtga

DBGET integrated database retrieval system