KEGG   Desmodus rotundus (common vampire bat): 112296490
Entry
112296490         CDS       T05907                                 

Definition
(RefSeq) granzyme B-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04210  Apoptosis
dro04650  Natural killer cell mediated cytotoxicity
dro04940  Type I diabetes mellitus
dro05202  Transcriptional misregulation in cancer
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112296490
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112296490
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    112296490
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112296490
   05330 Allograft rejection
    112296490
   05332 Graft-versus-host disease
    112296490
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112296490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112296490
Enzymes [BR:dro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     112296490
Peptidases and inhibitors [BR:dro01002]
 Serine peptidases
  Family S1: chymotrypsin family
   112296490
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Pico_P2A
Other DBs
NCBI-GeneID: 112296490
NCBI-ProteinID: XP_024407051
Position
Unknown
AA seq 258 aa
MKMWPLLLLHLMAFLLLPDAEAGEIIGGHEAKPHSHPYMAYLNIQDEKKMCGGVLVQKNF
VLTAAHCNGRLINVTLGAHNIQKQEKTQQVIQVKRTIPHPDYNAKNFSNDIMLLQLEKNI
KPTKAVKPLCLPRGEGRLWPGQNCTVAGWGKVAPQGRSSDTLQEVELTVQKDTVCEKLFN
HYYNRTIQLCVGNPVEKKASFQGDSGGPLMCHNRIQGIVSYGFRNGTAPRIFTKISSFLP
WIKKTMKSLKLQEPDYLL
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaagatgtggccactcctgctcctacacctgatggcctttttactactccctgatgca
gaggcaggggagatcatcgggggacatgaggcgaagccccactcccacccctacatggcc
tacctgaacattcaagatgaaaagaagatgtgtggcggtgttcttgtgcaaaaaaacttt
gttctgacagctgctcactgcaatggaaggttaatcaatgtcaccctgggggcccacaac
atccagaagcaggagaagactcagcaggtcatccaggtgaaaagaaccatcccccaccca
gactataatgctaagaacttctccaatgacatcatgttactgcagctggagaaaaacatc
aagccaactaaggctgtgaagcccctctgccttcccagaggtgaaggcaggttgtggcca
ggacagaactgcactgtggccggctggggaaaggtcgccccacagggcagatcgtcagac
acactgcaggaggtagagctgacagtgcagaaggatacagtgtgtgagaagctctttaac
cattattacaacaggaccattcaactctgcgtggggaacccagtggaaaaaaaggcttcc
tttcagggggactccgggggccctctcatgtgtcacaataggattcagggcattgtctcc
tatggattccgcaatgggacagcgccacggatcttcaccaaaatctcaagtttccttcct
tggataaagaaaaccatgaaaagcctcaaattgcaggagccagattatcttctctga

KEGG   Desmodus rotundus (common vampire bat): 112296591
Entry
112296591         CDS       T05907                                 

Definition
(RefSeq) granzyme H-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04210  Apoptosis
dro04650  Natural killer cell mediated cytotoxicity
dro04940  Type I diabetes mellitus
dro05202  Transcriptional misregulation in cancer
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112296591
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112296591
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    112296591
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112296591
   05330 Allograft rejection
    112296591
   05332 Graft-versus-host disease
    112296591
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112296591
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112296591
Enzymes [BR:dro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     112296591
Peptidases and inhibitors [BR:dro01002]
 Serine peptidases
  Family S1: chymotrypsin family
   112296591
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 112296591
NCBI-ProteinID: XP_024407142
Position
Unknown
AA seq 133 aa
MIRGHEAKPHSHPYMASLNIQDEKKMMCGGVLVQKNFVLTAAHCNGRLINVTLGAHNIQK
QEKTQQVIQVKRTIPHPDYNAKNFSNDIMLLQLERNLQLTDAVKLLHLLGGKDQLRPAQM
CTVAGWRPWRWSL
NT seq 402 nt   +upstreamnt  +downstreamnt
atgatcaggggacatgaggcgaagccccactcccacccctacatggcctccctgaacatt
caagatgaaaagaagatgatgtgtggcggtgttcttgtgcaaaaaaactttgttctgaca
gctgctcactgcaatggaaggttaatcaatgtcaccctgggggcccacaacatccagaag
caggagaagactcagcaggtcatccaggtgaaaagaaccatcccccacccagactataat
gctaagaacttctccaatgacatcatgttactgcagctggagagaaacctccagctgact
gatgctgtgaagctcctccacctgcttggaggtaaggaccagctgaggcctgcacagatg
tgcactgtggctggctggaggccatggagatggtcactttag

DBGET integrated database retrieval system