KEGG   Desmodus rotundus (common vampire bat): 112296519
Entry
112296519         CDS       T05907                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04064  NF-kappa B signaling pathway
dro04210  Apoptosis
dro04380  Osteoclast differentiation
dro04620  Toll-like receptor signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04622  RIG-I-like receptor signaling pathway
dro04623  Cytosolic DNA-sensing pathway
dro04625  C-type lectin receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04668  TNF signaling pathway
dro04722  Neurotrophin signaling pathway
dro04920  Adipocytokine signaling pathway
dro04926  Relaxin signaling pathway
dro04931  Insulin resistance
dro05132  Salmonella infection
dro05134  Legionellosis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112296519 (NFKBIA)
   04668 TNF signaling pathway
    112296519 (NFKBIA)
   04024 cAMP signaling pathway
    112296519 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112296519 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112296519 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    112296519 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    112296519 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    112296519 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    112296519 (NFKBIA)
   04660 T cell receptor signaling pathway
    112296519 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    112296519 (NFKBIA)
   04659 Th17 cell differentiation
    112296519 (NFKBIA)
   04657 IL-17 signaling pathway
    112296519 (NFKBIA)
   04662 B cell receptor signaling pathway
    112296519 (NFKBIA)
   04062 Chemokine signaling pathway
    112296519 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112296519 (NFKBIA)
   04926 Relaxin signaling pathway
    112296519 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112296519 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112296519 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112296519 (NFKBIA)
   05203 Viral carcinogenesis
    112296519 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112296519 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    112296519 (NFKBIA)
   05215 Prostate cancer
    112296519 (NFKBIA)
   05222 Small cell lung cancer
    112296519 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112296519 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112296519 (NFKBIA)
   05135 Yersinia infection
    112296519 (NFKBIA)
   05134 Legionellosis
    112296519 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112296519 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    112296519 (NFKBIA)
   05162 Measles
    112296519 (NFKBIA)
   05164 Influenza A
    112296519 (NFKBIA)
   05161 Hepatitis B
    112296519 (NFKBIA)
   05160 Hepatitis C
    112296519 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    112296519 (NFKBIA)
   05163 Human cytomegalovirus infection
    112296519 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112296519 (NFKBIA)
   05169 Epstein-Barr virus infection
    112296519 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112296519 (NFKBIA)
   05140 Leishmaniasis
    112296519 (NFKBIA)
   05142 Chagas disease
    112296519 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112296519 (NFKBIA)
   04131 Membrane trafficking [BR:dro04131]
    112296519 (NFKBIA)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    112296519 (NFKBIA)
Membrane trafficking [BR:dro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    112296519 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 112296519
NCBI-ProteinID: XP_024407081
Position
Unknown
AA seq 314 aa
MFHPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEDYEQMVKELREIRLQPQEAP
RSPEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCGSQHLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVIGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcaccctgccgagcacgcccaggactgggccatggagggcccccgggacgcgctc
aagaaggagcggttgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gactacgagcagatggtgaaggagctgcgggaaatccgcctccagccgcaggaggcgccg
cgtagcccggagccgtggaagcagcagctcaccgaggacggagactcgttcttgcacttg
gccatcatccatgaagagaaggcactgacaatggaagtggtccgccaagtgaagggagac
ctggcctttcttaacttccagaacaacctgcagcagactccgcttcacttggctgtgatc
accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccgt
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg
ggtgtcctgactcagagctgtgggtcccagcacctccactccatcctgcaggccaccaac
tacaatggccacacgtgtctgcacttagcctctatccatggctacctgggcatcgtggag
cttctggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggtcgaactgcc
cttcatcttgcggtggacctgcagaatccagacctggtgtctctcctgctgaagtgtggg
gctgacgtcaacagagtcacctaccagggctactccccataccagcttacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg
ccagagagtgaggatgaggagagttatgatacagagtccgagttcacagaggatgagctt
ccctatgacgactgcgtgatcggaggacagcgcctgacgttatga

KEGG   Desmodus rotundus (common vampire bat): 112302226
Entry
112302226         CDS       T05907                                 

Gene name
NFKBIE
Definition
(RefSeq) NF-kappa-B inhibitor epsilon
  KO
K05872  NF-kappa-B inhibitor epsilon
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04722  Neurotrophin signaling pathway
dro04920  Adipocytokine signaling pathway
dro05169  Epstein-Barr virus infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112302226 (NFKBIE)
   04658 Th1 and Th2 cell differentiation
    112302226 (NFKBIE)
   04659 Th17 cell differentiation
    112302226 (NFKBIE)
   04662 B cell receptor signaling pathway
    112302226 (NFKBIE)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112302226 (NFKBIE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112302226 (NFKBIE)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112302226 (NFKBIE)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112302226 (NFKBIE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112302226 (NFKBIE)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    112302226 (NFKBIE)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_3 Ank_5 Utp13
Other DBs
NCBI-GeneID: 112302226
NCBI-ProteinID: XP_024413620
Position
Unknown
AA seq 372 aa
MSEARKGTDEPDESQCDSGIECLRSLRSLPESTPASASGPSEGGGPEPWTHHPPGTAKQP
QEKEDTDGERADSIYGSSSLTESLTFWGGPETENPSPGSPPPPVGVLSPQQLEALTYISE
DGDTLIHLSVIHEAPAVLHCCLAFLPQEVLDIQNNLYQTALHLAVHLNQPGTVQALVQKG
ASRTLQDRHGDTALHVACQRQHLDCAHCLLKGQPEPGRGPSHSLDLQLQNWQGLTCLHIA
TLQRNQSLMKLLLENGADIDVQEGTSGKTALHLAVETQERGLVHFLLQAGARVDARMLNG
CTPLHLAAGRGLKSISSTLREAGADSLLRNVEDETPQDLAEDVTPQDLAEDPFALLPFDD
LKISGKPLMCAD
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcggaagcgcgcaaggggactgacgagccggacgagagccagtgtgattcgggcatc
gagtgcctgcgctctctgcgctccctgcccgaatccaccccggcctcagcctccgggccc
tcggagggcggaggccccgagccctggacccatcatcctccgggaacagccaaacagcca
caggagaaggaagacacagatggggagagggctgactccatctatggttcctcgtcgctc
acggagtctttgaccttttggggaggtcctgagaccgaaaacccatccccaggctcgccg
ccacccccagttggggtgctgagccctcagcagctggaagcactcacttatatctcggag
gacggagacacgctgatccacctgtccgtaattcacgaggccccagctgtgctgcactgt
tgcctggcttttctgccccaggaggtcctggacatacagaacaacctttaccagacagca
ctccacctggctgtgcatctgaaccagccaggcacagttcaggccctcgtgcagaagggg
gccagccgcacgctacaggaccggcacggcgacacagccctgcatgtggcctgccagcgc
cagcacctagactgtgcccactgcctgctgaagggacagccagagccaggcagaggacca
tctcactccctggacctccagctgcaaaactggcaaggtctgacctgtctccacattgcc
accctgcagaggaaccagtcactcatgaaactgcttcttgaaaatggagctgacattgac
gtgcaggagggcacgagtgggaagacagctctgcacctggctgtggagacccaggagcgg
ggtctggtgcactttctgctccaggctggggcccgggtagatgcccgtatgctcaacggg
tgcacacccctgcacctcgctgcaggccggggcctcaagagcatctcatccactctgcgt
gaggcaggtgctgactccctgctgcggaacgtggaggatgagacgccccaggacctggct
gaggatgtgacgccccaggacctggctgaggatccctttgctcttttgccctttgatgac
ctaaagatctctggaaagccactgatgtgtgccgactga

KEGG   Desmodus rotundus (common vampire bat): 112320245
Entry
112320245         CDS       T05907                                 

Gene name
NFKBIB
Definition
(RefSeq) NF-kappa-B inhibitor beta
  KO
K02581  NF-kappa-B inhibitor beta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04062  Chemokine signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04622  RIG-I-like receptor signaling pathway
dro04623  Cytosolic DNA-sensing pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04722  Neurotrophin signaling pathway
dro04920  Adipocytokine signaling pathway
dro05140  Leishmaniasis
dro05145  Toxoplasmosis
dro05162  Measles
dro05164  Influenza A
dro05169  Epstein-Barr virus infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112320245 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    112320245 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    112320245 (NFKBIB)
   04660 T cell receptor signaling pathway
    112320245 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    112320245 (NFKBIB)
   04659 Th17 cell differentiation
    112320245 (NFKBIB)
   04662 B cell receptor signaling pathway
    112320245 (NFKBIB)
   04062 Chemokine signaling pathway
    112320245 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112320245 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112320245 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112320245 (NFKBIB)
  09172 Infectious disease: viral
   05162 Measles
    112320245 (NFKBIB)
   05164 Influenza A
    112320245 (NFKBIB)
   05169 Epstein-Barr virus infection
    112320245 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112320245 (NFKBIB)
   05140 Leishmaniasis
    112320245 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112320245 (NFKBIB)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    112320245 (NFKBIB)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank_5 Ank Ank_4
Other DBs
NCBI-GeneID: 112320245
NCBI-ProteinID: XP_024433493
Position
Unknown
AA seq 353 aa
MAGVACLGKTVDADEWCDSGLGSLGPDAAAPGGPGLGSELDPGLSWAHLVFSYVTEDGDT
ALHLAVIHQHEPFLDFLLGYVAGTEYLDLQNDLGQTALHLAAILGEASAVEKLYTAGSGL
HVAERGGHTALHLACRVGARACARVLLQPRPQRLREAPNTYLTQGLHHTPDTNHTPVASY
PEPDLEKEEDKNEDWKLQLEAENYHGHTPLHVAVIHKDAEMVRLLWEAGADLNKPEPTCG
RSPLHLAVEAQAADVLELLLKAGADPAARMYGGRTPLGSAMLRPNPILAHLLRAHGAPEP
EDEDDKPGPCSSSSDSDSRDEGDEYDDIVVHSGRTADRIPLTQASKPLPDDPI
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggccggggtcgcttgcttggggaaaactgtggatgccgacgaatggtgtgacagtggc
ctgggctctctgggtccagatgcagcggctccgggaggaccgggactgggctcggagctg
gatccggggctgtcgtgggctcacctcgtcttcagctacgtcactgaggatggagacacg
gcactgcacttggctgtgattcatcagcatgagcccttcctggatttcctcctaggctat
gtggctggcactgagtatctggacctgcagaatgacctgggccagacggccctgcacctg
gcagccatcctgggggaggcatccgcagtggagaagttgtatacggcgggctccggattg
catgtggcagagcgtgggggccacacagctctgcacctggcctgccgtgtgggggcacgt
gcctgcgctcgagtgctgctccagccccgcccccagcgtctccgggaagcccccaacacc
tacctcactcagggcctgcaccacacccctgacaccaaccacacccctgttgcctcatac
cctgaacctgacttagagaaggaagaggataagaatgaggactggaagctgcagctggag
gctgaaaactaccacggccacaccccactccatgtggccgtcatccacaaagacgcagag
atggtccgactgctttgggaggccggagctgacctcaacaagccggagcccacgtgcggc
cggagccccctgcacttggcagtggaggcccaagcagctgatgtgctggagcttcttttg
aaggcaggtgctgaccctgctgcccgcatgtacggtggccgcactccactgggcagcgcc
atgctccggcccaaccccatcctcgcccacctcctccgtgcacacggtgcccctgaacct
gaggatgaggacgacaagcctggcccctgcagcagcagtagcgacagcgacagcagggat
gagggcgatgaatacgacgacatcgtggtccacagcggccggaccgcagaccggatacct
cttacccaagcctccaaacctctccctgacgaccccatctga

DBGET integrated database retrieval system