KEGG   Desmodus rotundus (common vampire bat): 112296535
Entry
112296535         CDS       T05907                                 

Gene name
NPAS3
Definition
(RefSeq) neuronal PAS domain-containing protein 3 isoform X1
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112296535 (NPAS3)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112296535 (NPAS3)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_9 HLH
Other DBs
NCBI-GeneID: 112296535
NCBI-ProteinID: XP_024407100
Position
Unknown
AA seq 922 aa
MAPTKPSFQQDPSRRERITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAA
RSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEG
PPPNTSVKVIGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSI
YLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTTEDGASSASSSSQSE
TPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSH
GRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVD
IVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKN
ANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNEN
SKSDEKGNQSENSEDPEPDRKKSGNTCDQDMNCNDQGHSSSNPDSRDSDDSFEHSDFENP
KAGEEGFGALGPMQIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQAPSKHQKR
KKRRKRQKGGSASRRRLSSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDN
DSSIWNYPPNREISRNESPYSMTKPPSSEHFPSPQSGGGSGGLHVAIPDSVLTPPGADGA
AARKTQFSASATTALAPVASDPLSPPLSASPRDKHPGGGSGGGGSGPSASNSLLYTGDLE
ALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQGNLLPNAHAV
NFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPTGNVFTTAEGLFS
TLPFPVYSNGIHAAQTLERKDD
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggcgcccaccaagcccagctttcagcaggatccttccaggcgagaacgaataactgcc
cagcatcctctgcccaaccaatcagaatgtaggaaaatctacagatatgacggaatctac
tgtgaatctacctaccagaatttacaagcattgagaaaagagaaatcccgagatgctgct
cgctcccgtcggggcaaagaaaattttgagttctatgaattggccaagttgttgcctctt
cctgcagccatcacaagccagcttgacaaggcgtccatcattcgacttaccatcagctat
ctgaaaatgagggactttgctaaccagggggaccctccgtggaacttgcgaatggaaggc
cctccaccaaacacatcagtaaaagttataggtgcacaacgaaggagaagccccagtgca
ctggccattgaagtatttgaagcacacttgggaagtcacattttgcagtccctggatggc
tttgtatttgcactaaatcaagaaggaaaatttttgtacatttctgaaacagtctccatc
tacctaggcctctcacaagtggagctgacaggcagcagcgtctttgactatgtccaccct
ggggaccacgtggagatggcagagcagctgggcatgaagctcccacctgggcggggtctc
ctctcgcagggtaccaccgaggacggagccagctcagcatcttcctcctcccagtcagag
acccctgagccagtggagtcaaccagccccagtctgctaaccactgacaacaccctagag
cgttcctttttcatccgaatgaagtctacgctgaccaaacgcggtgtgcacatcaaatca
tcaggatataaggtgattcatataacaggccggctacgactgcgggtgtcgctgtcccac
gggaggaccgtccccagccaaatcatgggtctcgtggttgtggcacatgccttgcctccc
cctacaatcaatgaagtcagaatcgactgccatatgttcgtcactcgagtaaatatggac
ctcaatatcatttactgtgaaaataggatcagcgattatatggatctgacccctgtagac
atcgtggggaagaggtgctaccacttcatccacgccgaggacgtcgagggcatcaggcac
agtcacttggacttgctgaataagggccagtgtgtgacgaagtattaccgttggatgcag
aagaacggaggctacatttggatacagtctagtgccaccatagctattaatgccaagaat
gcaaatgagaagaacatcatctgggtgaattatcttcttagtaatccggagtacaaagac
acgcctatggacatcgcccagctcccccacctgccggagaaaacgtcagaatcctcagag
acatctgactctgaatcagactctaaagacacctcaggtattacagaggacaatgagaac
tccaagtctgacgagaaggggaaccagtctgagaacagcgaagacccagagccagaccgg
aaaaagtcgggcaacacgtgcgaccaggacatgaactgcaacgaccaaggccacagctcc
agcaatcctgacagccgcgacagtgacgacagcttcgagcactcggactttgagaatccc
aaggcaggcgaggagggcttcggggccctaggccccatgcagatcaaggtggagcgctac
gtggagagcgagtcggacttgaggctgcagaactgcgagtcgctcacgtcagacagcgcc
aaggactcggacagtgcgggcgaggcgggcgcgcaggcccccagcaagcaccagaagcgc
aaaaagaggcggaaacggcagaagggtggcagcgccagccgaaggcgcctgtccagcgcg
tcgagccccggtggcctggacgccggcctggtggagcccccgcggctgctgtcctccccc
aacagtgcctcggtgctcaagatcaagacggagatctcggaacccatcaacttcgacaac
gacagcagcatctggaactacccacccaaccgggagatctccaggaacgagtccccctac
agcatgaccaagccccccagctccgagcacttcccgtccccgcagagcggtgggggcagc
gggggcctgcacgtggccatccctgactcggtcctcaccccaccaggcgccgacggtgca
gccgcccgcaagactcagttcagcgcctcagccaccacggctctggctcccgtcgcctcc
gatcctctgtcacccccgctctcggcgtccccgcgggacaagcaccccgggggcggcagc
gggggcggcgggagtggccccagcgcatccaactccttgctgtacactggggacctggag
gcgctgcagaggttgcaggctggcaacgtcgtgctcccgttggtgcacagggtgaccggg
actctggcggccaccagcacggctgcgcaaagggtctacaccacgggcaccatccgctac
gcgcccgccgaggtgaccctggccatgcagggcaacctgctgcccaacgcgcacgctgtt
aacttcgtggacgttaacagccccggcttcggccttgaccccaagacgcccatggagatg
ctctaccaccacgtgcacaggctcaacatgtcgggacccttcggcggcgctgtgagcgcg
gccagcctgacgcagatgcccacgggcaacgtgttcaccacggccgagggactcttctcc
acgctgcccttccctgtctacagcaacggcatccacgcggcacagactctggagcgcaag
gacgactga

DBGET integrated database retrieval system