KEGG   Desmodus rotundus (common vampire bat): 112297049Help
Entry
112297049         CDS       T05907                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04060  Cytokine-cytokine receptor interaction
dro04068  FoxO signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04217  Necroptosis
dro04650  Natural killer cell mediated cytotoxicity
dro04722  Neurotrophin signaling pathway
dro04932  Non-alcoholic fatty liver disease (NAFLD)
dro04940  Type I diabetes mellitus
dro05142  Chagas disease (American trypanosomiasis)
dro05143  African trypanosomiasis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05168  Herpes simplex virus 1 infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112297049 (FASLG)
   04010 MAPK signaling pathway
    112297049 (FASLG)
   04068 FoxO signaling pathway
    112297049 (FASLG)
   04151 PI3K-Akt signaling pathway
    112297049 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112297049 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112297049 (FASLG)
   04217 Necroptosis
    112297049 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112297049 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112297049 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112297049 (FASLG)
   05205 Proteoglycans in cancer
    112297049 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112297049 (FASLG)
   05330 Allograft rejection
    112297049 (FASLG)
   05332 Graft-versus-host disease
    112297049 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112297049 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    112297049 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112297049 (FASLG)
   05162 Measles
    112297049 (FASLG)
   05164 Influenza A
    112297049 (FASLG)
   05161 Hepatitis B
    112297049 (FASLG)
   05160 Hepatitis C
    112297049 (FASLG)
   05168 Herpes simplex virus 1 infection
    112297049 (FASLG)
   05163 Human cytomegalovirus infection
    112297049 (FASLG)
   05165 Human papillomavirus infection
    112297049 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    112297049 (FASLG)
   05143 African trypanosomiasis
    112297049 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112297049 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112297049 (FASLG)
   04052 Cytokines and growth factors [BR:dro04052]
    112297049 (FASLG)
   04090 CD molecules [BR:dro04090]
    112297049 (FASLG)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112297049 (FASLG)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Tumor necrosis fators
   112297049 (FASLG)
CD molecules [BR:dro04090]
 Proteins
  112297049 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF Tetraspanin EMP24_GP25L DUF3328 GspL_C GutM
Motif
Other DBs
NCBI-GeneID: 112297049
NCBI-ProteinID: XP_024407626
Position
Unknown
AA seq 281 aa AA seqDB search
MQQTLNYPYPQIYWVDSSTPSPWAPPGMVLPCPSSVPGRPGQRRPPPPPPPPTLPPPPPS
QLLPPLPLPPLKKRRDRNSSRCLLVMFFMVLVALVAVGLGMFQLFHLQKELAELRESSSQ
RHIESSLEKQIGYPNPPSEKREQRKAAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKGN
LVINDTGLYFVYSKVYFRGQSCKKQPLNHKVYMRNLKYPQDLVLMEEKMMDYCTAGQMWA
RSSYLGAVFNLTSADHLYVNVSELSLVNFEESKTFFGLYKL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagactctgaactacccatacccccaaatatactgggtggacagcagcaccccc
tccccctgggcccctccagggatggtcctcccctgtccctcctcagtgcctggaaggcct
ggtcagaggaggccaccaccaccgccaccaccaccaacactaccaccaccaccaccatca
caactgctgcctcccctgccactgccacctctgaagaagagaagggaccgcaactcaagc
cggtgtctcctggtgatgtttttcatggttctggtggccctggttgccgtggggctgggg
atgtttcagctgttccacttgcagaaggagctggccgaactcagagagtcttccagccaa
aggcatatagaatcatctttggagaagcaaatcgggtaccccaatccaccctctgagaaa
agggagcagaggaaagcagcccatttgacaggcaagcccaactccagatccatccctctg
gagtgggaagacacctacgggattgccctggtctctggggtgaagtacaagaagggcaac
cttgtgatcaacgacactggcttgtactttgtgtattccaaagtgtacttccggggtcag
tcctgcaagaagcagcccctgaaccacaaggtctatatgaggaacttgaagtatccgcag
gacctggtgctgatggaggagaagatgatggactactgcactgctggccagatgtgggcc
cgcagcagctacctgggcgccgtcttcaatctcaccagtgccgaccatttatacgttaac
gtgtctgagctctctctggtcaattttgaggaatctaagacattttttggcctatataag
ctctaa

DBGET integrated database retrieval system