KEGG   Desmodus rotundus (common vampire bat): 112297192
Entry
112297192         CDS       T05907                                 

Gene name
FCGR2B
Definition
(RefSeq) low affinity immunoglobulin gamma Fc region receptor II-b
  KO
K12560  low affinity immunoglobulin gamma Fc receptor II-b
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04145  Phagosome
dro04380  Osteoclast differentiation
dro04662  B cell receptor signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro05150  Staphylococcus aureus infection
dro05152  Tuberculosis
dro05162  Measles
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112297192 (FCGR2B)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112297192 (FCGR2B)
   04666 Fc gamma R-mediated phagocytosis
    112297192 (FCGR2B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112297192 (FCGR2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    112297192 (FCGR2B)
   05152 Tuberculosis
    112297192 (FCGR2B)
  09172 Infectious disease: viral
   05162 Measles
    112297192 (FCGR2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112297192 (FCGR2B)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dro04090]
    112297192 (FCGR2B)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    112297192 (FCGR2B)
CD molecules [BR:dro04090]
 Proteins
  112297192 (FCGR2B)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_5 DAG1 Podoplanin Protocadherin
Other DBs
NCBI-GeneID: 112297192
NCBI-ProteinID: XP_024407828
Position
Unknown
AA seq 307 aa
MGVPSVRPLPAAASDRAGCPSCCPWGHMLLWTALLVLASAAGTPSLPKAVVRLEPPWVNV
LREDNVTLHCQGPHGPGDGPTQWSRDGTPIPTQVWPRFSFKAQVNDSGDYRCQTGQTSPS
DPVRLNVTSDWLLLQTPRLLLQEGDPLVLRCHRWKNWPLFKITFFQDGTSKWYSPANSTY
FIPHANVSHSGKYHCSGFIGKKRHMSQPMSITVQGGSDSFLVTIVVAVVAGIAAVAGVAA
VVAWVCLRRHQSSGAPESREVGETPPEEPANLTHTEEAAKAEAENTITYSLLMHPEEDAG
LSDYQNV
NT seq 924 nt   +upstreamnt  +downstreamnt
atgggggttccctcagtccggcccctccctgctgcagcgagtgaccgggctggatgcccg
tcctgctgtccttggggccacatgctgctgtggacagctctgctggtcctggcctccgca
gctgggactcccagtctcccgaaggccgtggtgcgcctggagcccccctgggtcaacgtg
ctgcgggaggacaacgtgactctgcactgccaggggccccacggccctggggacggcccc
acccagtggtcccgtgacgggacccccatcccgacccaggtctggccccgcttcagcttt
aaggcccaagtcaacgacagcggggactacaggtgtcagacaggccagaccagccccagc
gaccctgtgcgtctgaacgtcacttccgactggctgctgctgcagaccccgcgcctgctg
ctgcaggagggcgaccccctcgtgctgaggtgccacaggtggaagaactggcctctgttc
aagatcacattcttccaggacggcacatccaagtggtactcccctgccaattccacctac
ttcatcccacatgctaacgtcagtcacagcggcaagtaccactgctctggattcatcggg
aagaagaggcacatgtcccagcctatgagcatcactgtccaaggtgggagtgactccttc
ctggtgaccatcgttgtggccgtggtcgcgggcatcgctgcagtggccggcgtggctgcc
gtggtggcctgggtctgcctcaggcggcaccagagctcaggagcccctgagagcagggaa
gtgggagagaccccacctgaggaaccagccaacctcacccacactgaagaggctgccaaa
gcggaggccgagaataccatcacctactccctgctcatgcacccggaggaggacgcgggg
ctctcggattaccagaacgtgtag

DBGET integrated database retrieval system