KEGG   Desmodus rotundus (common vampire bat): 112297492
Entry
112297492         CDS       T05907                                 

Definition
(RefSeq) RLA class I histocompatibility antigen, alpha chain 11/11-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112297492
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112297492
   04145 Phagosome
    112297492
  09143 Cell growth and death
   04218 Cellular senescence
    112297492
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112297492
   04612 Antigen processing and presentation
    112297492
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112297492
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112297492
   05330 Allograft rejection
    112297492
   05332 Graft-versus-host disease
    112297492
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112297492
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112297492
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112297492
   05170 Human immunodeficiency virus 1 infection
    112297492
   05168 Herpes simplex virus 1 infection
    112297492
   05163 Human cytomegalovirus infection
    112297492
   05167 Kaposi sarcoma-associated herpesvirus infection
    112297492
   05169 Epstein-Barr virus infection
    112297492
   05165 Human papillomavirus infection
    112297492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112297492
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112297492
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112297492
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112297492
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 C2-set_2 MHC_I_3 Ig_2
Other DBs
NCBI-GeneID: 112297492
NCBI-ProteinID: XP_024408030
Position
Unknown
AA seq 337 aa
MAELANLKPENKSWPGGTHSLHYHYLTLSEPGPGLPRFLAVGYVDDQPFLRYDSRVGRAE
PQAPWMASLDTQYWETETQKHRAWAEVQQVNLWTVMSYYNQSGGIHSAQRMFGCNIQEDS
LSSNFWHFGFDGQDHLSLDSETLSWVSAEPVAMQTKRLWDSERCYAEYDKAYLESLCLTS
LHRYLELGSQILTRREPPTVHVTRHTTQDRSATLRCWALGFYPQDISLSWWLGKQELALE
TEYVETRPSGDGTYQTWAAVQVPAGQEAAYTCRVQHSGLNHVLTVAWEPPSSQGLIAMVT
CAPLFLLAVVVVILTRRYLQGRNTEPYEQAPGGEEPI
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcagaactggccaacctgaagccagaaaacaagtcatggcctggagggacgcattcc
ctccactaccactacctcaccctgtcagagccaggccctggcctcccccggtttctggct
gtaggctacgtggatgaccagcccttcttacggtacgacagtcgtgtgggcagggccgag
ccccaggccccgtggatggcgtccttggacacccagtactgggagacagagacccagaag
cacagggcctgggcagaggtgcagcaggtgaacttgtggaccgtgatgagctactacaac
cagagtggaggcatacacagcgcccagcgcatgttcggctgtaatatccaggaggacagc
ctctccagcaacttctggcatttcggctttgatgggcaggaccacctgtccctggactca
gagactctgagctgggtgtcagctgagcctgtggccatgcagaccaagcgcttgtgggat
tcggagcgctgctacgctgagtatgacaaggcctacctggaaagcctctgcctcacctct
ctgcacaggtatctggagctgggaagccagatcctcacccggagagagccacccacagtg
cacgtgacaaggcacacaacccaggacaggagtgccacactgaggtgctgggccctgggc
ttctacccgcaggatatctcactgagctggtggctggggaagcaggagctggccctggag
actgagtatgtggagacccgccctagcggggacggcacctaccagacgtgggccgctgta
caggtgccagccgggcaggaggctgcgtacacctgccgtgtgcagcactctggcctgaac
cacgtgctcaccgtggcttgggaaccgccctctagtcaaggactcattgccatggttacc
tgtgcccccctcttcttgctggccgtggtagttgtgatcttgaccaggagataccttcaa
ggcaggaacacggaaccttatgaacaagccccaggtggagaggaacccatataa

KEGG   Desmodus rotundus (common vampire bat): 112302159
Entry
112302159         CDS       T05907                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04145  Phagosome
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04640  Hematopoietic cell lineage
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05140  Leishmaniasis
dro05145  Toxoplasmosis
dro05150  Staphylococcus aureus infection
dro05152  Tuberculosis
dro05164  Influenza A
dro05166  Human T-cell leukemia virus 1 infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112302159
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112302159
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112302159
   04612 Antigen processing and presentation
    112302159
   04658 Th1 and Th2 cell differentiation
    112302159
   04659 Th17 cell differentiation
    112302159
   04672 Intestinal immune network for IgA production
    112302159
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    112302159
   05322 Systemic lupus erythematosus
    112302159
   05323 Rheumatoid arthritis
    112302159
   05320 Autoimmune thyroid disease
    112302159
   05321 Inflammatory bowel disease
    112302159
   05330 Allograft rejection
    112302159
   05332 Graft-versus-host disease
    112302159
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112302159
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112302159
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    112302159
   05152 Tuberculosis
    112302159
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302159
   05164 Influenza A
    112302159
   05168 Herpes simplex virus 1 infection
    112302159
   05169 Epstein-Barr virus infection
    112302159
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112302159
   05140 Leishmaniasis
    112302159
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302159
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112302159
  Exosomal proteins of epithelial cells
   112302159
  Exosomal proteins of breast milk
   112302159
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig C2-set_2 DUF202
Other DBs
NCBI-GeneID: 112302159
NCBI-ProteinID: XP_024413521
Position
Unknown
AA seq 267 aa
MSGKREIPRGLWTAAVMVTLVVLSVPVAEGSDSPRDFVFQFKGLCYFTNGTQRVRHVERY
IYNRQEFVRFDSDVGEHRAVTELGRRDSESWNRDKDDLERRRAEVDTLCRHNYPMDEART
LNQRAAPTVTVYPAKTQRLQHHNLLVCSVNGFYPGHIEVRWLRNGQEEEDGVVSTGLIRN
GDWTFQIMVMLETVPRSGEVYTCHVQHPGQTVPVTVEWRAQSDSAQSKMLSGVGGFVLGL
LFLGAGLFVYFRNQKGHSGLQPTGLLS
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtctgggaaaagggagatccccagaggcctttggacagcagctgtgatggtgacgctg
gtggtgctgagtgtcccggtggctgagggcagtgactctccacgggacttcgtgttccag
tttaagggcctgtgttacttcaccaacgggacgcagcgggtgcggcatgtggaaagatac
atctacaaccggcaggagttcgtgcgcttcgacagcgacgtgggggagcaccgagcggtg
accgagctggggcggcgggactccgagagctggaaccgggacaaggacgacctggagcgg
aggcgggccgaggtggacacgttgtgcagacacaactacccgatggatgaggccaggacc
ttgaaccagcgagctgcgcctacagtgacggtgtaccctgcaaagacgcagcgcctgcag
caccacaacctcctggtctgctctgtgaacggcttctaccccggccacattgaagtccgg
tggctgcggaacggccaggaagaggaggatggggtcgtctccacaggcctgatccggaac
ggagactggaccttccagatcatggtgatgctggaaaccgttccccggagtggggaggtc
tacacctgccacgtgcagcaccccggccagacggtccctgtcaccgtggaatggagggcg
cagtctgactctgcacagagcaagatgctgagtggagtcgggggcttcgtgctgggtctg
ctcttccttggggcggggctgttcgtctacttcaggaatcagaaaggacactctggactt
cagccaacaggactcctgagctga

KEGG   Desmodus rotundus (common vampire bat): 112302160
Entry
112302160         CDS       T05907                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain-like
  KO
K06752  MHC class II antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04145  Phagosome
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04640  Hematopoietic cell lineage
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05140  Leishmaniasis
dro05145  Toxoplasmosis
dro05150  Staphylococcus aureus infection
dro05152  Tuberculosis
dro05164  Influenza A
dro05166  Human T-cell leukemia virus 1 infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112302160
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112302160
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112302160
   04612 Antigen processing and presentation
    112302160
   04658 Th1 and Th2 cell differentiation
    112302160
   04659 Th17 cell differentiation
    112302160
   04672 Intestinal immune network for IgA production
    112302160
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    112302160
   05322 Systemic lupus erythematosus
    112302160
   05323 Rheumatoid arthritis
    112302160
   05320 Autoimmune thyroid disease
    112302160
   05321 Inflammatory bowel disease
    112302160
   05330 Allograft rejection
    112302160
   05332 Graft-versus-host disease
    112302160
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112302160
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112302160
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    112302160
   05152 Tuberculosis
    112302160
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302160
   05164 Influenza A
    112302160
   05168 Herpes simplex virus 1 infection
    112302160
   05169 Epstein-Barr virus infection
    112302160
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112302160
   05140 Leishmaniasis
    112302160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302160
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112302160
  Exosomal proteins of epithelial cells
   112302160
  Exosomal proteins of breast milk
   112302160
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 Ig_2 SKG6 I-set
Other DBs
NCBI-GeneID: 112302160
NCBI-ProteinID: XP_024413522
Position
Unknown
AA seq 255 aa
MILNRALIWGTLALITMMSLCGGEDIVADHVAAYGTSVYQSYGPSGQYTFEFDGDEEFYV
DLQKKETIWRLPEFSKFGGFDPQGGLREVATSKHNLEVLIKCSNSTAAVNEVPEVTVFPK
SRVELGQPNTLICAVDNIFPPVVNITWLSNGHPVTQGVSETSFLSKNDHSFLKISYLTFL
PSADDIYDCRVEHWGLDGPLLKHWEPEIPTPMSELTETVVCAVGLAVGLVGIVVGTVFII
QGLRPGGASRHPGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacagagctctgatttgggggaccctcgccctgatcaccatgatgagtctc
tgtggaggtgaagacattgtggctgaccacgttgctgcctatggcacaagcgtctaccag
tcctacggcccctctggccagtacacgtttgaatttgacggagacgaggagttctacgtg
gacctgcagaagaaggagacaatctggcggctgcctgagttcagcaaattcggaggtttt
gacccacagggtggactgagagaagtggctacatcaaaacacaatttggaagtcttaatt
aaatgctccaactctactgcggctgtcaatgaggttcctgaagtgactgtgtttcctaag
tctcgagtggagctgggtcagcctaacaccctcatctgtgccgtggacaatatcttccct
cctgtggtcaacatcacgtggctaagcaatgggcacccagtcacacagggtgtttccgaa
accagcttcctgtccaagaatgatcattccttcctcaagatcagctacctcaccttcctg
ccttctgccgacgacatttacgactgcagggtggagcactggggcctggacgggccactt
ctgaaacactgggagcctgagattcctactcccatgtcagagctgacagagactgtggtc
tgcgccgtggggctggccgtgggcctcgtgggcatcgtggtgggcaccgtcttcattatc
cagggcctgcgcccaggtggtgcctccagacacccagggcccttgtga

KEGG   Desmodus rotundus (common vampire bat): 112302240
Entry
112302240         CDS       T05907                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04145  Phagosome
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04640  Hematopoietic cell lineage
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05140  Leishmaniasis
dro05145  Toxoplasmosis
dro05150  Staphylococcus aureus infection
dro05152  Tuberculosis
dro05164  Influenza A
dro05166  Human T-cell leukemia virus 1 infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112302240
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112302240
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112302240
   04612 Antigen processing and presentation
    112302240
   04658 Th1 and Th2 cell differentiation
    112302240
   04659 Th17 cell differentiation
    112302240
   04672 Intestinal immune network for IgA production
    112302240
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    112302240
   05322 Systemic lupus erythematosus
    112302240
   05323 Rheumatoid arthritis
    112302240
   05320 Autoimmune thyroid disease
    112302240
   05321 Inflammatory bowel disease
    112302240
   05330 Allograft rejection
    112302240
   05332 Graft-versus-host disease
    112302240
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112302240
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112302240
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    112302240
   05152 Tuberculosis
    112302240
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302240
   05164 Influenza A
    112302240
   05168 Herpes simplex virus 1 infection
    112302240
   05169 Epstein-Barr virus infection
    112302240
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112302240
   05140 Leishmaniasis
    112302240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302240
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112302240
  Exosomal proteins of epithelial cells
   112302240
  Exosomal proteins of breast milk
   112302240
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig C2-set_2 I-set
Other DBs
NCBI-GeneID: 112302240
NCBI-ProteinID: XP_024413638
Position
Unknown
AA seq 263 aa
MSTLLQLLLGLSVSCTGAGGFVAHVESTCVLDDDGTPQDFTYCISFNKDLLACWDPMEKA
IVPCEFGMLYKLAAYVSGYLNQQENLIQRLSEGLQDCATHTQPFWGSLTQRTRPPSVQVA
KTTPFNTRESVVLACYVWGFYPADVTITWRKNGQLVPPHGSAHKVAQPNGDWTYQTLSHL
ATTPSFGDTYICVVEHIGAPEPILQYWTPGLSPAQTVKVSVSVATLGLGLIILSLGLLSW
RRAGSSGYTVLPGSNFPEGRPIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgagcacactcctgcagctgctgctgggcctcagcgtgagctgcaccggagcaggtggc
tttgtggcccacgtggaaagcacctgtgtgctggacgatgacgggactccacaggatttc
acgtactgtatctctttcaacaaagacttgctggcctgctgggatcccatggagaaagca
atagtcccttgtgaatttgggatgctgtataaattggccgcttacgtctccggttacctc
aaccaacaggaaaacctgatccagcgcttatctgaggggctccaggactgtgccacacac
acacagcccttttggggatcactgacccaaaggacacggcctccatctgtgcaagtggcc
aaaaccactccttttaacacgagggagtccgtggtgctggcctgctacgtgtggggcttc
tacccagccgatgtgaccatcacgtggaggaagaacgggcagcttgtccctcctcatggc
agtgcccataaggttgcccagcccaatggagactggacgtaccagaccctctcccattta
gccacaactccctcttttggggacacctacatctgtgtggtggagcacattggggctcct
gagcccatccttcagtactggacacctggactgtccccggcacagacagtgaaggtttct
gtgtccgtagcgactctaggcctgggcctcatcatcctctctctcggtttgctcagctgg
cggagagctggctcctctggctacactgtcctccctggctccaattttccagaaggtcgg
cccatttcttag

KEGG   Desmodus rotundus (common vampire bat): 112302328
Entry
112302328         CDS       T05907                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04145  Phagosome
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04640  Hematopoietic cell lineage
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05140  Leishmaniasis
dro05145  Toxoplasmosis
dro05150  Staphylococcus aureus infection
dro05152  Tuberculosis
dro05164  Influenza A
dro05166  Human T-cell leukemia virus 1 infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112302328
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112302328
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112302328
   04612 Antigen processing and presentation
    112302328
   04658 Th1 and Th2 cell differentiation
    112302328
   04659 Th17 cell differentiation
    112302328
   04672 Intestinal immune network for IgA production
    112302328
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    112302328
   05322 Systemic lupus erythematosus
    112302328
   05323 Rheumatoid arthritis
    112302328
   05320 Autoimmune thyroid disease
    112302328
   05321 Inflammatory bowel disease
    112302328
   05330 Allograft rejection
    112302328
   05332 Graft-versus-host disease
    112302328
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112302328
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112302328
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    112302328
   05152 Tuberculosis
    112302328
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302328
   05164 Influenza A
    112302328
   05168 Herpes simplex virus 1 infection
    112302328
   05169 Epstein-Barr virus infection
    112302328
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112302328
   05140 Leishmaniasis
    112302328
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302328
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112302328
  Exosomal proteins of epithelial cells
   112302328
  Exosomal proteins of breast milk
   112302328
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 112302328
NCBI-ProteinID: XP_024413747
Position
Unknown
AA seq 254 aa
MALTGAPVSGLFIAVLLASLPGSWAVKEDHVIIQAEFYMNPHPSGEFMFDFDGDEIFHVD
MGKRETVWRLEEFGHFASFEAQGALANIAVDKANLDIMIKRSNHTPDTNVPPDVTVFPNN
PVELGEPNTLICFIDKFSPPLVNVTWLRNGKPLTTGVSETVFLPREDHLFRKFYYLPFLP
SAEDVYDCKVEHWGLDEPLLKHWEFEARTPLPETTENVVCGLGLVVGLVGIIVGTIFIIK
GVRKGSAADRRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccctaactggagctccagtgtcggggctgttcatcgcagttctcctggcgagcctt
ccggggtcgtgggctgtcaaagaggatcatgtgatcattcaggccgagttctatatgaac
ccacacccatcaggcgagtttatgtttgacttcgatggtgatgagattttccacgtggat
atgggaaagagggagacggtctggcggcttgaagaatttggtcattttgccagctttgag
gctcagggcgcattggccaatatagctgtggacaaagccaacctggacatcatgataaag
cgctccaaccacaccccggacactaatgtacctccagatgtgactgtgttcccaaacaac
cctgtggaactgggagagcccaacaccctcatctgtttcatcgacaagttctccccacca
ctggtcaacgtcacatggcttcgaaacggaaagcctctcacaaccggagtatcggagaca
gtcttcctgcccagggaggaccaccttttccgcaagttttactacctccccttcctgccc
tcagctgaggacgtgtatgactgcaaggtggagcactggggcttggatgagcctcttctc
aagcactgggagtttgaagcacgaactcccctcccagagacaacagagaatgtggtgtgt
ggcctgggcctggttgtgggtctggtgggcatcattgttgggaccatcttcatcatcaag
ggcgtgcgcaaaggcagtgctgctgaccgccgaggcccgctgtga

KEGG   Desmodus rotundus (common vampire bat): 112302342
Entry
112302342         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112302342
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112302342
   04145 Phagosome
    112302342
  09143 Cell growth and death
   04218 Cellular senescence
    112302342
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112302342
   04612 Antigen processing and presentation
    112302342
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112302342
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112302342
   05330 Allograft rejection
    112302342
   05332 Graft-versus-host disease
    112302342
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112302342
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112302342
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302342
   05170 Human immunodeficiency virus 1 infection
    112302342
   05168 Herpes simplex virus 1 infection
    112302342
   05163 Human cytomegalovirus infection
    112302342
   05167 Kaposi sarcoma-associated herpesvirus infection
    112302342
   05169 Epstein-Barr virus infection
    112302342
   05165 Human papillomavirus infection
    112302342
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302342
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112302342
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112302342
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112302342
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set MHC_I_3 ig Marek_A
Other DBs
NCBI-GeneID: 112302342
NCBI-ProteinID: XP_024413766
Position
Unknown
AA seq 524 aa
MRVMRCPALLLLLSAALPLTGAGAGPHSLRYFDTAVSRAGGGEAWFLVAGYVDGAEFVRF
DSDAANASMEPREPWMELEEPQYWVSETQNAWRTAKIYRLSLNSVRLYYNQSEDGSHTLQ
VMYGCDVWPNGTVLRGYDQSAYDGADYLALNEDQRSWTAADTAAQNTQRKWEAAGVAERF
GAYVRGPCRETLLRYLEHGKETLQRAGTGPSSHPQPPGWAPTGDWTRDQGQNPLPAPGDG
VRPDFPIPYQSDPAFLRGHWGAASPGKEGTRPETSGQRLPLTRSAAPARGDFPSQVRSSP
APASLGPTGRSLATGPPPPQVWTRNALSTQTGLHLGCVPLVLELSTDQGITPGAFVQAGS
GLCAPSPPCCPVQSRDGPWSTAAQPHVRVQFPSLPPLTLTWQRDGVDQPQDTQLVETRPW
DNSTFQTWAEVVVPRGEEQRYTCHVVHAGLPEPLRLQWEPPAQTISSIIIIVGIVIGLAL
LGAVAVAAVMWARRRSGEKGRSYTQAASSDSDQGSDVSLTACKE
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgcgggtcatgcggtgtccggctctcctgctgctgctctcggcggcgctgccgctgacc
ggtgccggggcgggtccgcactccctgaggtatttcgacaccgccgtatcccgggctggc
ggcggggaggcgtggttccttgtagccggctacgtggacggcgcggagttcgtgcggttc
gacagcgacgctgcaaacgcgagcatggagccgcgggagccgtggatggagctggaggaa
ccgcagtattgggtcagcgagacgcagaatgcttggagaaccgcaaagatttaccgattg
agcctgaacagcgtgcgcctctactacaaccagagcgaggacgggtctcacactctccag
gtgatgtacggctgcgacgtctggccgaacgggaccgtcctccgcgggtacgatcagtcc
gcctacgacggcgccgactacctcgccctgaacgaggaccagcgctcctggaccgcggcc
gacacggcggctcagaacacgcagcgcaagtgggaggcggccggtgtggcggagcgattc
ggggcctacgtgcggggcccctgcagggagacgctcctgcggtacctggaacacgggaag
gagacgctgcagcgcgcaggtactgggccgtcctcccacccccaacccccgggctgggct
cccacgggggactggacgcgggaccagggtcagaacccgctccctgcgccgggagacgga
gtccgcccggactttccgatcccgtaccagagcgaccccgccttccttcggggacactgg
ggggcagcctctcctgggaaggagggaacgcgccccgagacctccggacagcgccttcct
ttgacccggtctgcggccccggcccgcggggacttcccatctcaggtccgctccagcccc
gcacccgcgagtctgggtcccaccgggcgctccttggccacggggccgccccccccccaa
gtctggaccagaaatgctctctccacccagaccggcctccacctgggctgcgtccctctg
gttctagaactttcgacagaccaggggatcaccccaggtgcctttgtccaggccgggtct
gggctttgcgccccctctcccccttgctgccctgtccagtcccgggacggcccctggagc
accgccgcacagccccacgtacgtgtgcagttcccgagtctcccacccttaaccctgacc
tggcagcgagatggggtggaccagccccaggacacacagcttgtggagaccaggccctgg
gataacagtaccttccagacgtgggcggaggtggtggtgccacgtggagaggagcagaga
tacacgtgccacgtggtgcacgcggggctgcccgagcccctgaggctgcagtgggagccg
cctgctcagaccatcagcagcatcatcatcatcgtgggcattgtcattggcctggccctg
ctgggagctgtggcagttgcagctgtgatgtgggcgaggaggcgctcaggagaaaaagga
aggagctacactcaggctgccagcagtgacagtgaccagggctcggatgtgtctctcaca
gcttgtaaagagtga

KEGG   Desmodus rotundus (common vampire bat): 112302354
Entry
112302354         CDS       T05907                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04145  Phagosome
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04640  Hematopoietic cell lineage
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05140  Leishmaniasis
dro05145  Toxoplasmosis
dro05150  Staphylococcus aureus infection
dro05152  Tuberculosis
dro05164  Influenza A
dro05166  Human T-cell leukemia virus 1 infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112302354
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112302354
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112302354
   04612 Antigen processing and presentation
    112302354
   04658 Th1 and Th2 cell differentiation
    112302354
   04659 Th17 cell differentiation
    112302354
   04672 Intestinal immune network for IgA production
    112302354
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    112302354
   05322 Systemic lupus erythematosus
    112302354
   05323 Rheumatoid arthritis
    112302354
   05320 Autoimmune thyroid disease
    112302354
   05321 Inflammatory bowel disease
    112302354
   05330 Allograft rejection
    112302354
   05332 Graft-versus-host disease
    112302354
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112302354
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112302354
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    112302354
   05152 Tuberculosis
    112302354
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302354
   05164 Influenza A
    112302354
   05168 Herpes simplex virus 1 infection
    112302354
   05169 Epstein-Barr virus infection
    112302354
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112302354
   05140 Leishmaniasis
    112302354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302354
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112302354
  Exosomal proteins of epithelial cells
   112302354
  Exosomal proteins of breast milk
   112302354
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6
Other DBs
NCBI-GeneID: 112302354
NCBI-ProteinID: XP_024413786
Position
Unknown
AA seq 261 aa
MDHEWGPGAALLLLLHLLWLLPHSWTAPQGTTPWWRDNLQNHTFQHTMYCQDWSPSVGLS
EAYDDDQLFSFNFSQNTRVPRLPEFADWAQKFGDTSTIFFDKGFCQTMIQKIGPILKGKI
PESRGIPVAEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVTWQHHWAPVEGAGPTFLSAVD
GLSFQAFSYLNFTPAPSDLFSCVVTHEIDGHTAIAYWVPNNALPSDLLENVLCGVALGLG
VLGIIVGLVLIIYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggatcatgagtggggccccggagctgcactgctgctgctgctacaccttctgtggctg
ctgccccactcctggactgcccctcaaggtacgacaccctggtggcgagataacctgcag
aaccacacgttccagcacacaatgtactgtcaggactggagtcccagcgtgggactgtcc
gaggcctacgacgatgaccagcttttctccttcaacttctcccagaacacccgagtgcct
cgcctgcctgaatttgctgactgggctcagaagtttggagatacttccaccattttcttt
gacaaaggattctgccaaaccatgatccagaaaattggcccaatacttaaagggaaaatc
ccagagtctagagggattcccgtcgctgaggtgttcacgctgaagcccctggagttcggc
aaacccaacacgctggtctgtttcgtcagtaatctcttcccacccacattgacggtgacc
tggcagcatcattgggcccctgtggaaggtgccgggcctactttcctctcagccgttgat
ggactcagcttccaggccttttcttacttaaacttcacaccggcaccctctgaccttttc
tcctgtgtcgtgactcacgagattgacggccacacagcaattgcctattgggtgcccaac
aacgcgctgccctcagatcttctggagaatgtgctgtgcggtgtggccttaggcctgggt
gtgctgggcatcattgttggcttggtcctcatcatctacttccggaagccttgctcagga
gactga

KEGG   Desmodus rotundus (common vampire bat): 112302447
Entry
112302447         CDS       T05907                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q9 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112302447
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112302447
   04145 Phagosome
    112302447
  09143 Cell growth and death
   04218 Cellular senescence
    112302447
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112302447
   04612 Antigen processing and presentation
    112302447
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112302447
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112302447
   05330 Allograft rejection
    112302447
   05332 Graft-versus-host disease
    112302447
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112302447
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112302447
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302447
   05170 Human immunodeficiency virus 1 infection
    112302447
   05168 Herpes simplex virus 1 infection
    112302447
   05163 Human cytomegalovirus infection
    112302447
   05167 Kaposi sarcoma-associated herpesvirus infection
    112302447
   05169 Epstein-Barr virus infection
    112302447
   05165 Human papillomavirus infection
    112302447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302447
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112302447
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112302447
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112302447
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 112302447
NCBI-ProteinID: XP_024413858
Position
Unknown
AA seq 219 aa
MRVLGCPSLLLLLSAALPLTGAGAGERGVGRERPPGPHSLRYFDTAVSRPGGGEARFISV
GYVDGTEFVRFDSDAANPRMEPRAWWMEGPWVEEVDPKYWDEQTQVAQGNAQTFRVSLHN
VIGYYNQSEHGSHTLQRMHGCDVGRDGALLRGYHQLAYDGADYIALNEDQRSWTAADTAA
QNTQRKWEAAGVAERFGAYVRGLCREWLLLYLEHRKETL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcgcgtcttgggatgtccgagcctcctgctgctgctctcggcggcgctgccgctaacc
ggtgccggggcgggtgagcgcggggtcgggagggagcggcctccaggtccgcactccctg
aggtatttcgacaccgccgtgtcccggcccggcggcggggaggcccggttcatctccgtg
ggctacgtggacggcacggagttcgtgcggttcgacagcgacgccgcgaacccgaggatg
gagccgcgggcgtggtggatggaggggccgtgggtggaggaggtggacccgaagtattgg
gacgagcagacgcaggtcgcccagggaaacgcacagactttccgagtgagcctgcacaat
gtgatcggatactacaaccagagcgagcacgggtctcacactctccagaggatgcacggc
tgcgacgtggggcgtgacggggccctgctccgcgggtatcaccagctcgcatacgatgga
gcggactacatcgccctgaacgaggaccagcgctcctggaccgcggccgacacggcggct
cagaacacgcagcgcaagtgggaggcggccggtgtggcggagcgattcggggcctacgtg
cggggcctgtgcagggagtggctgctgctgtacctggaacacaggaaggagaccctg

KEGG   Desmodus rotundus (common vampire bat): 112302469
Entry
112302469         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112302469
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112302469
   04145 Phagosome
    112302469
  09143 Cell growth and death
   04218 Cellular senescence
    112302469
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112302469
   04612 Antigen processing and presentation
    112302469
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112302469
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112302469
   05330 Allograft rejection
    112302469
   05332 Graft-versus-host disease
    112302469
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112302469
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112302469
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302469
   05170 Human immunodeficiency virus 1 infection
    112302469
   05168 Herpes simplex virus 1 infection
    112302469
   05163 Human cytomegalovirus infection
    112302469
   05167 Kaposi sarcoma-associated herpesvirus infection
    112302469
   05169 Epstein-Barr virus infection
    112302469
   05165 Human papillomavirus infection
    112302469
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302469
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112302469
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112302469
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112302469
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 112302469
NCBI-ProteinID: XP_024413875
Position
Unknown
AA seq 372 aa
MRTVSSLAVLLLFEAVAWIEAWAGPHTLRYFYTVMSPPGGGETHFVAVGYVDDTQFVRFD
SRYVNARMEPRAPWMEGPWVEEEDPQYWDVETRNVKETAQNFRVNLNKLRSHYNQSLHEP
HTFQWTYGCEMGSDGSFLRGFDQFAYDGADYITLNEDLSSWTAARAEAQVSQRIYEAMHE
AEVQRHYLERECIKWLKRYLEKGKESLQRSDPPKTHVTHHPASEREATLRCWAQGFYPAD
IALTWQRDGEDLTQYMELVETRPEGDGTFQTWAAVVVPRGEEQRYTCHVVHAGLPEPLRL
QWEPPSQTISSIIIIVGIVIGLALLGAVAVAAVMWARRRSGEKRGSCAWAASSDSDRGLD
VSFIASKGETLM
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgcggaccgtgagttccctagccgtccttctcctcttcgaggccgtggcgtggatcgag
gcctgggctggtcctcacaccctgagatatttctacaccgtcatgtccccgccgggcggc
ggggagacccacttcgttgccgtcggctacgtggacgacacgcagttcgtgcggttcgac
agccgctacgtgaatgcgaggatggagccgcgggcgccgtggatggaggggccgtgggtg
gaggaggaggacccacagtattgggacgtagagacgaggaatgttaaggaaaccgcacag
aatttccgagtgaacctgaacaaactgcgctctcactacaaccagagcctacacgagcct
cacaccttccagtggacctacggctgcgagatgggatcggatggcagcttcctccgcggt
tttgaccagttcgcgtacgacggcgccgactatatcactttgaacgaggacctgagctct
tggaccgcggcccgcgcggaggctcaggtgtcccagcgcatatatgaagctatgcatgag
gcggaggtccagaggcactacctggagagggagtgcataaagtggctcaaaagatacctg
gaaaaagggaaggagtctctgcagcgctcagatcctccaaagacacatgtgacccaccac
cccgcctccgagcgggaggccaccctgaggtgctgggcgcagggcttctaccctgcggac
atcgccctgacctggcagcgggacggggaggacctgacccagtacatggagcttgtggag
accaggcccgagggggacgggaccttccagacgtgggcggcggtggtggtgcctcgagga
gaggagcagagatacacgtgccacgtggtgcacgcggggctgcccgagcccctgaggctg
cagtgggagccgccttctcagaccatcagcagcatcatcatcatcgtgggcattgtcatt
ggcctggccctgctgggagctgtggcagttgcagctgtgatgtgggcgaggaggcgctca
ggtgaaaaaagagggagctgcgcttgggctgccagcagtgacagtgaccggggcttggat
gtgtctttcatagcttctaaaggtgagaccctgatgtag

KEGG   Desmodus rotundus (common vampire bat): 112313872
Entry
112313872         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, alpha chain E-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112313872
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112313872
   04145 Phagosome
    112313872
  09143 Cell growth and death
   04218 Cellular senescence
    112313872
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112313872
   04612 Antigen processing and presentation
    112313872
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112313872
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112313872
   05330 Allograft rejection
    112313872
   05332 Graft-versus-host disease
    112313872
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112313872
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112313872
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112313872
   05170 Human immunodeficiency virus 1 infection
    112313872
   05168 Herpes simplex virus 1 infection
    112313872
   05163 Human cytomegalovirus infection
    112313872
   05167 Kaposi sarcoma-associated herpesvirus infection
    112313872
   05169 Epstein-Barr virus infection
    112313872
   05165 Human papillomavirus infection
    112313872
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112313872
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112313872
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112313872
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112313872
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 112313872
NCBI-ProteinID: XP_024426260
Position
Unknown
AA seq 445 aa
MLESFTGSHSHWVSEQQPAAALARGRVLTRIWNSFSSDAPVWLLGSRTLLLLSGTLALTQ
TWAAPVGPTAKPGRASSRLPGPHTLRYLSTTVFETDSGKYRYIVVAYVDDTEIWSYDSNT
SSPRLQPRFLRKELLRGEREHAKFWKIQEREIKHNEQMSRANLNRLSAHYNQSDRGPHTW
QEMTACVVGSDGTFLSGFSQFAYDGTDCVALNLDLRNWTFAAGICWRNDVWVPDADVRRA
FLEHGCVHQLHLLLEKGKETLLRANPPKTHVTHHPFSDHEVTLRCWALCFYPSDITLTWQ
RDGEDLTQDMDLVETRPVGDGTFQKWAAVAVPPGEEQRYTCQVQHQGLPEPLTLRWDPRP
QTTMTTVGIAAAALGLLVAAAAAAVLWRRRRSGGQGVGLRFLSPGGQAQVEVCSASLMGI
VSPLGCLSIWGLFPTTDPLVRPVGK
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgctcgagagcttcaccggttctcactctcattgggtgtcggagcagcagcccgcggcc
gcgctggccaggggacgcgtgctcaccagaatctggaactcattctcctccgacgctcca
gtgtggctcttggggtcccgaaccctcctgctgctctccgggaccctggccctgacccag
acctgggcggcccccgtgggcccgactgcgaagccaggacgcgcgtcctcccggctccca
ggcccccacaccctgagatatttaagcaccaccgtgttcgaaacggacagcgggaaatac
cggtacatcgtggtcgcctacgtggacgacacggagatctggagttatgacagcaacaca
agcagcccgaggctgcagccgcgctttctgaggaaggagctgctgcggggggagcgggag
catgcaaaattttggaagattcaagagcgggaaataaagcacaacgaacagatgagcaga
gcgaacctgaacaggctgagcgcgcactacaatcagagcgaccgcgggccccacacttgg
caggaaatgaccgcctgcgtcgtgggatcggacgggacgttcctcagcgggtttagtcag
ttcgcctacgacggcaccgactgcgtcgccctgaacctggacctgcgcaactggaccttt
gccgcagggatctgctggagaaacgacgtgtgggtccctgatgcggacgtcaggagggcc
ttcctggagcacggatgcgtgcaccagctccacctgctcctggagaaggggaaggagacg
ctgctccgagcaaaccctccaaagacacacgtgacccaccaccccttctctgaccacgag
gtcaccctgaggtgctgggccctgtgcttctacccttcggacatcaccctgacctggcag
cgtgatggggaggacctgacccaggacatggacctggtggagaccaggcctgtgggggat
ggaaccttccagaagtgggcggccgtggctgtgccccctggggaggagcagagatacacg
tgccaagtgcagcaccaggggctgcctgagcctctgaccctgagatgggacccccgtcct
cagaccaccatgaccaccgtgggcatcgctgctgctgccctgggcctccttgtagctgca
gctgctgcagctgtgctgtggaggaggaggcgctcaggtgggcaaggggtggggctgagg
ttcctgtcccctgggggccaagcccaggtggaagtgtgctctgcctccttaatgggcatc
gtgtcccctcttgggtgcttgtccatctggggcctatttcctaccacggaccctttagtg
aggcccgtgggaaagtga

KEGG   Desmodus rotundus (common vampire bat): 112313873
Entry
112313873         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-2 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112313873
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112313873
   04145 Phagosome
    112313873
  09143 Cell growth and death
   04218 Cellular senescence
    112313873
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112313873
   04612 Antigen processing and presentation
    112313873
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112313873
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112313873
   05330 Allograft rejection
    112313873
   05332 Graft-versus-host disease
    112313873
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112313873
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112313873
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112313873
   05170 Human immunodeficiency virus 1 infection
    112313873
   05168 Herpes simplex virus 1 infection
    112313873
   05163 Human cytomegalovirus infection
    112313873
   05167 Kaposi sarcoma-associated herpesvirus infection
    112313873
   05169 Epstein-Barr virus infection
    112313873
   05165 Human papillomavirus infection
    112313873
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112313873
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112313873
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112313873
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112313873
SSDB
Motif
Pfam: C1-set Ig_3 MHC_I_C ig Ig_2 C2-set_2 I-set
Other DBs
NCBI-GeneID: 112313873
NCBI-ProteinID: XP_024426261
Position
Unknown
AA seq 190 aa
MSAAGLSHDHAKFPNFLTLPSDPPKTHVTHHPISDHEVTLRCWALGFYPSDITLTWQRDG
EDLTQDMDLVETRPVGDGTFQKWAAMDVPPGEEQRYTCQVQHQALPKPLTLKWDPPPQTT
ITILGITAATLGLLGAVGAGAVLWRRRHSGNDGAKGSDVFLTAPKASEHVCIVISFIAGA
GHEATLPTGT
NT seq 573 nt   +upstreamnt  +downstreamnt
atgagcgctgctggactgtcccatgaccatgcaaagttcccaaattttctcaccctcccc
tcagaccctccaaagacacacgtgacccaccaccccatctctgaccacgaggtcaccctg
aggtgctgggccctgggcttctacccttcggacatcaccctgacctggcagcgtgacggg
gaggacctgacccaggacatggacctggtggagaccaggcctgtaggggacgggaccttc
cagaagtgggcggccatggacgtgccccctggggaggagcagagatacacgtgccaagtg
cagcaccaggcgctgcccaagcccctgaccctgaaatgggacccccctcctcagaccacc
ataaccatcctgggcattactgctgccaccctgggcctccttggagctgtgggcgctgga
gctgtgctgtggaggaggaggcactcaggcaatgacggtgccaagggctctgatgtgttt
ctcacagctcctaaggcatcagaacatgtctgcattgttatcagcttcattgcaggagct
ggtcacgaggccaccctccccacagggacctga

KEGG   Desmodus rotundus (common vampire bat): 112313875
Entry
112313875         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112313875
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112313875
   04145 Phagosome
    112313875
  09143 Cell growth and death
   04218 Cellular senescence
    112313875
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112313875
   04612 Antigen processing and presentation
    112313875
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112313875
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112313875
   05330 Allograft rejection
    112313875
   05332 Graft-versus-host disease
    112313875
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112313875
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112313875
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112313875
   05170 Human immunodeficiency virus 1 infection
    112313875
   05168 Herpes simplex virus 1 infection
    112313875
   05163 Human cytomegalovirus infection
    112313875
   05167 Kaposi sarcoma-associated herpesvirus infection
    112313875
   05169 Epstein-Barr virus infection
    112313875
   05165 Human papillomavirus infection
    112313875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112313875
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112313875
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112313875
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112313875
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 Ig_2 ig
Other DBs
NCBI-GeneID: 112313875
NCBI-ProteinID: XP_024426263
Position
Unknown
AA seq 385 aa
MEPQTLLLLLSGALAMTETWAGPHALKYFSTIVSGPGRGKYRYIVVGYVDDTEVVRFDSD
GASSRLEPRVPWLEQWWAEHGDPHFWEEQTHAVKDYGQSFRAILNNLRAYYNQSEDGSNT
FQDMSGCVVGLDRSLLRLYSQYAYDGTEYIALNVDLSSDTAADKGVRITANRNLVQNPNV
EGWKLCLEGLCESWLHLFLAKGKETLLRADPPKSHLTHHPISDHEVNLRCWALGFYPADI
TLTWQRDGEDLTQDMELVETRPAGDGTFQKWAAVVVPPGEEQRYTCRVQHQALPEPLTLR
WDPPSQTTMTTVAIAAAALGLLGAAAAAAVLWRRRRSDRDKKSYSQAACSDSAQGSDVSL
TAPKGETLRAENAESWKVMAKEPNS
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggagccccaaacgctgctcctgctgctctcgggggccctggccatgaccgagacctgg
gcaggcccccacgcactgaaatatttcagcaccatcgtgtccggacctggccgcgggaag
taccggtacatcgtcgttggctacgtggacgacaccgaggtcgtgcggttcgacagcgac
ggcgcgagctcgaggctggagccgcgggtgccgtggctggagcaatggtgggcggagcac
ggggatccacatttttgggaagagcagacccacgccgtgaaggactacgggcagagtttc
cgagccatcctgaacaacctgcgcgcctactacaaccagagcgaggacgggtctaacacc
ttccaggatatgagcggctgcgtcgtggggttggacaggagccttctccgcttgtacagt
cagtacgcctacgacggcactgaatacatcgcccttaacgtggacctgagctccgacaca
gcggcggacaagggggtccggatcaccgccaatcgcaatttggtgcagaatcctaacgtg
gaaggctggaagctctgcctcgagggcctttgcgagtcctggctccacctgttcctggcg
aagggaaaggagacgctgctacgagcagacccaccaaagtcacaccttacccaccacccc
atctctgaccatgaggtcaacttgaggtgctgggccctgggcttctaccctgcggacatc
accttgacctggcagcgtgacggggaggacctgacccaggacatggagctggtggagacc
aggcctgcgggggatgggaccttccagaagtgggcagccgtggtcgtgccccctggggag
gagcagagatacacgtgccgtgtgcagcaccaggcgctgcctgagcccctgaccctgaga
tgggaccccccttctcagaccaccatgaccaccgtggccatcgctgctgccgccctgggt
ctccttggagctgcagccgctgcagctgtgctgtggaggaggaggcgctcagacagggac
aagaagagctactctcaggctgcctgcagcgacagtgcccagggctctgatgtgtctctc
acagctcctaagggtgagaccctgagggcagaaaatgctgagtcctggaaggtcatggcc
aaggagccaaattcctga

KEGG   Desmodus rotundus (common vampire bat): 112313876
Entry
112313876         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, B-1 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112313876
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112313876
   04145 Phagosome
    112313876
  09143 Cell growth and death
   04218 Cellular senescence
    112313876
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112313876
   04612 Antigen processing and presentation
    112313876
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112313876
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112313876
   05330 Allograft rejection
    112313876
   05332 Graft-versus-host disease
    112313876
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112313876
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112313876
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112313876
   05170 Human immunodeficiency virus 1 infection
    112313876
   05168 Herpes simplex virus 1 infection
    112313876
   05163 Human cytomegalovirus infection
    112313876
   05167 Kaposi sarcoma-associated herpesvirus infection
    112313876
   05169 Epstein-Barr virus infection
    112313876
   05165 Human papillomavirus infection
    112313876
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112313876
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112313876
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112313876
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112313876
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig Ig_2 C2-set_2 I-set
Other DBs
NCBI-GeneID: 112313876
NCBI-ProteinID: XP_024426264
Position
Unknown
AA seq 447 aa
MMVMGPQTLLLLLSGALALRRTGAGECGAGQRGSRGSPTTWRRRITAPQAQTPDSRFARL
KYRYIVVGSVDRTEIVRFDSGTARPRLEPQVPWMQQPWVELEDPDLGEEQTREMKHNEQT
SRANLNKLLAYYNQSEDGSHTFQDRTRCVLGSDGRILRGYSRFAYDGTDYLALNKDLRSW
TTVYTASGISWHPLVRVPEANVRRFFLEDTCVHRLRLLLEKGNEMLLRADPPNTHVTHHP
IFDHEVTLRCWALGFYPSDITLTWQRDGEDLTQDMELVETRPAGDGTFQKWAAMDVPPGE
EQRYTCQVQHQVLPKPLTLRWDPPPQTTMTTVGIAAAALGLLGAVAAGAVLWRRRRSGGQ
GRYSQAACSDSAQGSHVSLTAPKECDSSETDLNLFMTTVFPSVTELLSVGLGAETVIAAS
PWDFKDPRLLFLHLASECVCVLISVIM
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgatggtgatggggccccaaaccttgctcctgctgctctccggggccctggccctgaga
aggaccggggctggtgagtgcggggcaggacagaggggatcccgcgggagcccaacgacc
tggagaaggcgcatcacagccccccaggcccagaccccagattcccgcttcgcccggcta
aaataccggtacatcgttgtcggctccgtggaccgcacggagatcgtgcggttcgacagc
ggcacagcgaggccgaggctggagccgcaggtaccgtggatgcagcagccgtgggtggag
ctggaggatccagatttgggggaggaacagacacgggaaatgaagcacaatgagcagact
tcccgagcgaacctgaacaagcttctcgcctactacaaccagagcgaggacggatctcac
accttccaggataggacccgctgcgtcctgggctcagacgggcgcatcctccgcgggtac
agtcggttcgcctacgacggcaccgactacctcgccctgaacaaggacctgcgctcctgg
accacggtgtacacggcgtctgggatcagctggcaccccttggtgcgggtccctgaagcg
aacgtcaggagattcttcctggaggacacgtgcgtgcaccggctccgcctgctcctggag
aaggggaatgagatgctcctccgagcagaccctccaaatacacacgtgacccaccacccc
atctttgaccacgaggttaccctgaggtgctgggccctgggcttctacccttcggacatc
accctgacctggcagcgtgacggggaggacctgacccaggacatggagctggtggagacc
aggcctgcaggggacgggaccttccagaagtgggcggccatggatgtgccccctggggag
gagcagagatacacgtgccaagtgcagcaccaggtgctgcccaagcccctgaccctgaga
tgggacccccctcctcagaccaccatgaccaccgtgggcatcgctgctgccgccctgggt
ctccttggagctgtggccgctggagctgtgctgtggaggaggaggcgctcaggtgggcaa
gggagatactctcaggctgcctgcagtgacagtgcccagggctctcatgtgtctctcacg
gctcctaaggaatgtgacagttctgagactgacctgaatttgttcatgacaactgtcttt
cccagcgtgacagagctgctttcggtgggtctcggtgctgaaacagtcattgcagcctcc
ccttgggacttcaaggatccccgcctgctgtttctgcacctggcatcggaatgtgtctgt
gttctcatcagtgtcatcatgtga

KEGG   Desmodus rotundus (common vampire bat): 112313879
Entry
112313879         CDS       T05907                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, B-39 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112313879
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112313879
   04145 Phagosome
    112313879
  09143 Cell growth and death
   04218 Cellular senescence
    112313879
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112313879
   04612 Antigen processing and presentation
    112313879
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112313879
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112313879
   05330 Allograft rejection
    112313879
   05332 Graft-versus-host disease
    112313879
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112313879
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112313879
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112313879
   05170 Human immunodeficiency virus 1 infection
    112313879
   05168 Herpes simplex virus 1 infection
    112313879
   05163 Human cytomegalovirus infection
    112313879
   05167 Kaposi sarcoma-associated herpesvirus infection
    112313879
   05169 Epstein-Barr virus infection
    112313879
   05165 Human papillomavirus infection
    112313879
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112313879
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112313879
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112313879
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112313879
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 Ig_2 ig Trp_oprn_chp
Other DBs
NCBI-GeneID: 112313879
NCBI-ProteinID: XP_024426265
Position
Unknown
AA seq 419 aa
MEHRLLLLLLPGALTLTETWAGPHTMRIFSTVLSGPGPGKTRYISVYYADDTEIMRFDSE
APNPSVEPRVPWMEQAWVEKQMPGYWNERTGVCQREAQINEGNLNKLSANYNQSDHGSHT
LQKISGCVVGSDGRFLRGHSQIAYDGTDYVALNLDLRSWTTANSAAHITSHNLVQIPYAE
TLKVFLEGTCVHWLHLFLEKGKETLLRADPPKTHVTHHPISDHEVTLKCWALGFYPADIT
LTWQRDGEDLTQDMELVETRPGGDGTFQKWAAIAVPPGEEQRYTCRVQHQALPQPLTLRW
DPPPQTTMTTMGIITAAALSLLVAXAAGAVLWRRRRSGKGRERYSQAAYSDSAQGSDVSL
TGPKDAESWKVMAEELMSLVASSESSSSRESPWDTSGHGFVATSDSICIGTDNRPVEFG
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggagcaccgactcctgctcctgctgctcccgggggccctgaccctgaccgagacctgg
gccggtccccacaccatgagaattttcagcactgttctgtccggaccgggccccgggaag
acccggtacatcagcgtctattacgcggacgacacggagatcatgcggttcgacagcgag
gccccgaatccgagtgtggagccgcgggtaccctggatggaacaggcatgggtggagaag
cagatgccgggctattggaacgagcggacaggggtttgccagcgcgaggcacagattaac
gaagggaacctgaacaagctgagcgccaactacaaccaaagcgatcatggctctcacacc
ttacagaaaataagtggctgtgtcgtggggtccgacgggcgcttcctccgcgggcacagt
cagatcgcctacgacggcaccgactacgtcgccctgaacctggacctgcgctcctggacc
acggccaactctgcggcccatatcacctcgcacaacttggtgcagatcccttatgcggag
accttgaaggtcttcctagagggcacttgtgtgcactggctacacctgttcctggagaag
gggaaggagacgctgctccgagcagaccctccaaagacacacgtgacccatcaccccatc
tctgaccacgaggtcaccctgaagtgctgggccctgggcttctaccctgcggacatcacc
ctgacctggcagcgtgatggggaggacctgacccaggacatggagcttgtggagaccagg
cctgggggggacgggaccttccagaagtgggcggccatagctgtgccccccggggaggag
cagagatacacgtgccgtgtgcagcaccaggcgctgccccagcccctgaccctgagatgg
gacccccctcctcagaccaccatgaccaccatgggcatcatcactgctgccgccctgagt
ctccttgtagctngggccgctggagctgtgctgtggaggaggaggcgctcaggcaaaggc
agggagagatactctcaggctgcctacagcgacagtgcccagggctctgatgtgtctctc
acaggtcctaaagatgctgagtcctggaaggtcatggccgaggagctgatgtccttagtg
gcttcctctgagagttcctcctcaagagagagcccttgggacacaagtggccacggtttc
gtagctacttcagactccatctgcatcggcacggacaacaggcctgtggagttcgggtga

KEGG   Desmodus rotundus (common vampire bat): 112313880
Entry
112313880         CDS       T05907                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-15 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112313880
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112313880
   04145 Phagosome
    112313880
  09143 Cell growth and death
   04218 Cellular senescence
    112313880
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112313880
   04612 Antigen processing and presentation
    112313880
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112313880
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112313880
   05330 Allograft rejection
    112313880
   05332 Graft-versus-host disease
    112313880
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112313880
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112313880
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112313880
   05170 Human immunodeficiency virus 1 infection
    112313880
   05168 Herpes simplex virus 1 infection
    112313880
   05163 Human cytomegalovirus infection
    112313880
   05167 Kaposi sarcoma-associated herpesvirus infection
    112313880
   05169 Epstein-Barr virus infection
    112313880
   05165 Human papillomavirus infection
    112313880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112313880
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112313880
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112313880
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112313880
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2 ig
Other DBs
NCBI-GeneID: 112313880
NCBI-ProteinID: XP_024426266
Position
Unknown
AA seq 308 aa
MEPGFLVLLSATLALSETWAGPHTIRYFSTVVSRPSIRKPWYIGIAYLDDTEIARYDSEA
PSPKLKPQVPWLEQPWVEQEHPHFWDDYTTDIKNYEQMYGGNLNNLRAYYNQSKDVWHTF
QEMSGCIVGLDWHFLRGYTQFAYDGTDYIALNEDLSSWTTADTAARITWRNLVQVEDADH
WRRILESTWVHWIHLFLENEKEMLLRADPPKTHVTHHPISDHEVTLRCWALGFYPADITL
TWQRDGEDLTQDTELVETRPVGDGTFQKWAAVAVPPGEEQRYTCRVQHEALPELLTLRWD
PPPQTTMT
NT seq 924 nt   +upstreamnt  +downstreamnt
atggaacctggattcctcgtgctgctctcggcgaccctggctctgtccgagacttgggcc
ggcccccacaccataagatatttcagcacggtggtgtccagacccagcataaggaagccc
tggtacataggtattgcctacttggacgacacggaaattgcccggtacgacagtgaagcg
cctagtccaaagctgaagcctcaggtaccgtggctggagcagccgtgggtggagcaggag
cacccacatttttgggacgactacacgacagacatcaagaactacgaacagatgtacgga
gggaacctgaacaacctgcgcgcctactacaaccagagcaaggacgtgtggcacaccttc
caggaaatgagtggctgcatcgtggggttggactggcacttcctccgcggatacactcag
tttgcctatgacggcaccgactacatcgccctgaacgaggacctgagctcctggaccact
gccgacacagcggcccggatcacctggcgcaacttggtgcaggttgaagatgcggaccac
tggaggagaatcctagagagcacgtgggtgcactggatccacctgttcctggagaatgaa
aaggagatgctgctccgagcagaccctccaaagacacacgtgacccaccaccccatctct
gaccacgaggtcaccctgaggtgctgggccctgggcttctaccctgcggacatcaccctg
acctggcagcgtgacggggaggacctgacccaggacacagagcttgtggagaccaggcct
gtgggggatggaaccttccagaagtgggcagccgtggctgtgccccctggggaggagcag
agatacacatgccgtgtccagcatgaggcgctgcctgagctcctgaccctgagatgggac
ccccctcctcagaccaccatgacc

KEGG   Desmodus rotundus (common vampire bat): 112314045
Entry
112314045         CDS       T05907                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-36 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112314045
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112314045
   04145 Phagosome
    112314045
  09143 Cell growth and death
   04218 Cellular senescence
    112314045
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112314045
   04612 Antigen processing and presentation
    112314045
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112314045
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112314045
   05330 Allograft rejection
    112314045
   05332 Graft-versus-host disease
    112314045
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112314045
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112314045
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112314045
   05170 Human immunodeficiency virus 1 infection
    112314045
   05168 Herpes simplex virus 1 infection
    112314045
   05163 Human cytomegalovirus infection
    112314045
   05167 Kaposi sarcoma-associated herpesvirus infection
    112314045
   05169 Epstein-Barr virus infection
    112314045
   05165 Human papillomavirus infection
    112314045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112314045
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112314045
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112314045
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112314045
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Ig_2 TSP_NTD
Other DBs
NCBI-GeneID: 112314045
NCBI-ProteinID: XP_024426421
Position
Unknown
AA seq 328 aa
MGCRPLLLLFSGALALIETWAGPHTLTVFSTAVSGPGRGKSRYIVVGYVDHTEIVRFDSN
AARQRLEPRVPWMEQPWVELEHPHFWDQKTRDIRNYEKIYGGNVDNLRHYYNQSEDGSHT
FQEMTSCVVRSDRSFLRGYTQFAYDGTDYITLNEDMRSWTATDAAARITWRKLVELPAAE
RRRGVLGDVCVRWLHLFLENGKETLLGADPPKTYVTHHPISDHEVTLKCWALGFYPSDIT
LTWQRDGEDLTQEMDLVETRPAGDGTFQKWAAVAVPPREEQRYTCRVQHEALPKPLILRW
GRSRESYSQATYSDSAQDAEVSLTAPNG
NT seq 987 nt   +upstreamnt  +downstreamnt
atggggtgcagaccgctgctcctgctgttctcgggagccctggccctgatcgagacctgg
gccggtccccacacgctgacggtattcagcaccgctgtgtccggacccggccgcgggaag
tcccggtacatcgtcgtcggctacgtggaccacacggagatcgtgcggttcgacagcaac
gccgcaaggcagaggctggagccgcgggtaccatggatggagcagccgtgggtggagctg
gagcatccacatttttgggaccagaagacgcgggacatcagaaactatgaaaagatatat
ggagggaacgtggacaacctgcgccactactacaaccagagcgaggacgggtctcacacc
ttccaggaaatgaccagctgtgtagtgagatcggacaggagcttcctccgtggatacact
cagttcgcttacgacggcaccgactacatcaccctgaacgaggacatgcgctcctggacc
gcaaccgacgcggcggcccggatcacctggcgcaagttggtggagctccctgctgcagag
cggcggcggggagtcctaggggacgtatgcgtgcgctggctccacctgttcctagaaaac
ggaaaggagacgctgctaggagcagaccctccaaagacatacgtgacccaccaccccatc
tctgaccacgaggtcaccctgaagtgctgggccctgggcttctacccttcggacatcacc
ctgacctggcagcgtgatggggaggacctgacccaggaaatggacctggtggagaccagg
cctgcgggggacgggaccttccagaagtgggcggctgtggccgtgccccccagggaagag
cagagatacacgtgccgtgtgcagcatgaggcgctgcccaagcccctgattctgagatgg
ggcagaagcagggagagctactctcaggctacctacagcgacagtgcccaggatgctgag
gtttctctcacagctcccaacgggtga

KEGG   Desmodus rotundus (common vampire bat): 112314059
Entry
112314059         CDS       T05907                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112314059
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112314059
   04145 Phagosome
    112314059
  09143 Cell growth and death
   04218 Cellular senescence
    112314059
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112314059
   04612 Antigen processing and presentation
    112314059
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112314059
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112314059
   05330 Allograft rejection
    112314059
   05332 Graft-versus-host disease
    112314059
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112314059
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112314059
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112314059
   05170 Human immunodeficiency virus 1 infection
    112314059
   05168 Herpes simplex virus 1 infection
    112314059
   05163 Human cytomegalovirus infection
    112314059
   05167 Kaposi sarcoma-associated herpesvirus infection
    112314059
   05169 Epstein-Barr virus infection
    112314059
   05165 Human papillomavirus infection
    112314059
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112314059
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112314059
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112314059
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112314059
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 Ig_2 C2-set_2 ig I-set
Other DBs
NCBI-GeneID: 112314059
NCBI-ProteinID: XP_024426436
Position
Unknown
AA seq 386 aa
MEPRTLVLLLSGALAVILSESWAAPAVLPGPTADSGGASFPPLDTHTLRIFSTFVSRPGR
RKNRYIGLSYVDHTEILRLDSGMLNPRLEPRVPWLGQQLVEQEDPHLWEEQTRIWKENQH
CFRAALNNLRAYYNQSEDVSHTHQERSGCVVGSDWSFLRGYSQLAYDGTEYVALNLDLRN
LTVTDTATEITWRNLLPNLDVNSWRISLEDLCWRWFHIFLKKGKETLLRADPPKTHVTHH
PISDHEVTLKCWALGFYPADITLTWQRDGEDLTQDMELVETRSAGDGTFQKWAAMDVPPG
EEQRYTCRVQHQALPEPLTLRWDPPPQTTMTTVGITAAALGLLGAVAAGAVLWRRRRSGR
CRESCAPAVYSDSAQGSDVSLTAPKE
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggagccccgaacccttgtcctgctgctctcgggggccctggccgtgatcctgagcgag
agctgggcagcacctgctgttcttcctggcccgacagctgactcgggaggcgcgtccttc
ccgcccctagacacccacactctgcgaattttcagcacctttgtgtccagaccgggccgc
aggaagaaccggtacatcggcctcagctacgtggaccacacggagatcctgcggctcgac
agtggcatgctaaacccgaggctggagccgcgagtaccgtggctggggcagcagctggtg
gagcaggaggatccacatttgtgggaggagcagacgcgtatctggaaggagaaccaacac
tgttttcgagcggccctgaacaacctgcgcgcctactacaatcagagcgaagacgtgtcg
cacacccaccaggaaaggagtggctgcgttgtggggtcggactggagcttcctccgcggg
tacagtcagctcgcctacgacggcactgagtacgtcgccctgaacctggacctgcgcaac
ttgactgtgactgataccgcgactgagatcacttggcgtaatttgttaccaaaccttgat
gtgaactcttggaggatcagcctggaggacctgtgctggcgctggttccatatcttcctg
aagaaggggaaggagacgctgctccgagcagaccctccaaagacacacgtgacccaccac
cccatctctgaccacgaggtcaccctgaagtgctgggccctgggcttctaccctgcggac
atcaccctgacctggcagcgtgacggggaggacctgacccaggacatggaacttgtggag
accaggtctgcgggggacgggaccttccagaagtgggcagccatggatgtgcctcctggg
gaggagcagagatacacctgccgtgtgcagcaccaggcgctgcctgagcccctgaccctg
agatgggacccccctcctcagaccaccatgaccactgtgggcatcactgctgccgccctg
ggcctccttggagctgtggccgctggagctgtgctgtggaggaggaggcgctcaggcaga
tgcagggagagctgcgctcctgctgtctacagcgacagtgcccagggctctgatgtgtct
ctcacagctcctaaggagtga

KEGG   Desmodus rotundus (common vampire bat): 112314061
Entry
112314061         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112314061
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112314061
   04145 Phagosome
    112314061
  09143 Cell growth and death
   04218 Cellular senescence
    112314061
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112314061
   04612 Antigen processing and presentation
    112314061
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112314061
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112314061
   05330 Allograft rejection
    112314061
   05332 Graft-versus-host disease
    112314061
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112314061
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112314061
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112314061
   05170 Human immunodeficiency virus 1 infection
    112314061
   05168 Herpes simplex virus 1 infection
    112314061
   05163 Human cytomegalovirus infection
    112314061
   05167 Kaposi sarcoma-associated herpesvirus infection
    112314061
   05169 Epstein-Barr virus infection
    112314061
   05165 Human papillomavirus infection
    112314061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112314061
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112314061
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112314061
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112314061
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 Ig_2 C2-set_2 ig EphA2_TM I-set
Other DBs
NCBI-GeneID: 112314061
NCBI-ProteinID: XP_024426438
Position
Unknown
AA seq 381 aa
MLRVWIMGYRPLVLLLSGALALTETWAGSHTMRIFTTFVSGPDRGKSRYIGIVYADDTEI
LRFDSDAPNPRLEPRVQWMEQPWVEQETPGYWKDRTGVCQRYAQINQQNVNKLRAHYNQS
EDVSHTFQEMSGCVVDPDGRFIRGYSQLAYDGTDYLALNEDMSSWTAADTDTITERNLVQ
IPDAESKKAYLKRTCVRRLLKYLEKGKETLLRADPPKTHVTHHPISDHEVTLRCWALGFY
PSDITLTWQRDGEDLTQDTELVETRPAGDGTFQKWAAMDVPPGEEQRYTCRVQHQALPKP
LILRWDPPPQTTMTTVGIAAAALCLLVAAAAAAVLWRRRRSDRDKKSYSQAACSDSAQGS
DVSLTAPKGETLRSRSGGHGN
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgctcagggtctggatcatgggttaccgacctctggtcctgctgctctcgggggccctg
gccctgacggagacctgggccggttcccacaccatgagaattttcaccaccttcgtgtcc
ggaccggaccgcgggaagtcccggtacatcggcatcgtctacgcggacgacacggagatc
ctgcggttcgacagcgacgccccgaacccgaggctggagccgcgggtgcagtggatggag
cagccgtgggtggagcaggagacaccgggctattggaaagatcggaccggggtttgccag
cgctacgcacagattaaccaacagaacgtgaacaagctgcgcgcccactacaaccagagc
gaggacgtgtcccacaccttccaggaaatgagtggctgcgtggtggacccggacggacgc
ttcatccgcgggtacagtcaattagcctacgacggcaccgactacctggctttgaacgag
gacatgagctcctggactgccgcggacacggacacgatcaccgagcgcaacttggtgcag
atccctgatgcggagagcaagaaggcctacctgaagagaacgtgcgtgcgccggctcctc
aagtacctggagaaggggaaggagacgctactccgagcagaccctccaaagacacacgtg
acccaccaccccatctctgaccatgaggtcaccctgaggtgctgggccctgggcttctac
ccttcggacatcaccctgacctggcagcgtgacggggaggacctgacccaggacacagag
cttgtggagaccaggcctgcaggggacgggaccttccagaagtgggcggccatggacgtg
ccccccggggaggagcagagatacacatgccgtgtgcagcaccaggcgctgcccaagccc
ctgattctgagatgggacccccctcctcagaccaccatgaccaccgtgggcattgctgct
gctgccctgtgtctccttgtagctgcagccgctgcagctgtgctgtggaggaggaggcgc
tcagacagggacaagaagagctactctcaggctgcctgcagcgacagtgcccagggttct
gatgtgtctctcacagctcctaagggtgagactctgaggtcaagaagtggggggcatggg
aactga

KEGG   Desmodus rotundus (common vampire bat): 112314062
Entry
112314062         CDS       T05907                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-48 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112314062
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112314062
   04145 Phagosome
    112314062
  09143 Cell growth and death
   04218 Cellular senescence
    112314062
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112314062
   04612 Antigen processing and presentation
    112314062
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112314062
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112314062
   05330 Allograft rejection
    112314062
   05332 Graft-versus-host disease
    112314062
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112314062
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112314062
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112314062
   05170 Human immunodeficiency virus 1 infection
    112314062
   05168 Herpes simplex virus 1 infection
    112314062
   05163 Human cytomegalovirus infection
    112314062
   05167 Kaposi sarcoma-associated herpesvirus infection
    112314062
   05169 Epstein-Barr virus infection
    112314062
   05165 Human papillomavirus infection
    112314062
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112314062
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112314062
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112314062
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112314062
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 Ig_2 ig Rod_cone_degen
Other DBs
NCBI-GeneID: 112314062
NCBI-ProteinID: XP_024426440
Position
Unknown
AA seq 376 aa
MGPRTLLLLLSEVLALTQTWAGLHNVRIFSTSVSGPGRGKNRYVVVGYVDDTEILRFDSD
TARPRLEPRVPWREQPWVEQEHPHFWDEKTRVCKYNQQTFRANLNSLRHYYNQSEDGSHT
YQEMSGCVLESDSRFLRGFSQFAYDGTDYITLNEDLRSWTAADTAARITWRNLVQVPDVE
RRRLAIGDSCERWLRLFLENGKEMLLRADPPKTHVTHHPISDHEVTLRCWALGFYPADIT
LTWQRDGEDLTQDTELVETRPVGDGTFQKWAAVAVPPGEEQRYTCRVQHEALPELLTLRW
DPPPQTTMTIVGIAAAALGLLVAVGAGAMLWRRRHSGRGRERYSQAACSDRAQGSDVSLT
APKGETLKAGNGGHWD
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgggccccagaactctgctcctgctgctctcggaggtcctggccctgacccagacctgg
gccggcctccacaacgtgagaatttttagcacctccgtgtctggaccgggccgcgggaag
aaccggtacgtggtggtgggctacgtggacgacaccgagatcttgcggttcgacagcgac
accgccaggccgaggctggagccgcgggtaccgtggagggagcagccgtgggtggagcag
gagcacccacatttttgggatgagaagacgcgggtctgcaagtacaaccaacagactttc
cgagcaaacctaaacagcctgcgccactactacaaccagagcgaggatgggtctcacacc
taccaggaaatgagtggctgcgtcttggagtccgactccagattcctgcgtgggttcagt
cagttcgcctatgatggaactgactacattacgctgaacgaggacctgcgctcctggacc
gctgcggacacggcagctcggatcacctggcgcaacttggtgcaagtgcctgatgtggag
cgacggaggctcgccattggagactcctgcgagcgctggctccgcctgttcctagagaac
gggaaggagatgctgctccgagcagaccctccaaagacacacgtgacccaccaccccatc
tctgaccacgaggtcaccctgaggtgctgggccctgggcttctaccctgcggacatcacc
ctgacctggcagcgtgacggggaggacctgacccaggacacagagcttgtggagaccagg
cctgtgggggatggaaccttccagaagtgggcagccgtggctgtgccccctggggaggag
cagagatacacatgccgtgtccagcatgaggcgctgcctgagctcctgaccctgagatgg
gacccccctcctcagaccaccatgaccatcgtgggcattgctgctgctgccctgggtctc
cttgtagctgtgggcgctggagctatgctgtggaggaggaggcactcaggcagaggcagg
gagaggtactctcaggctgcctgcagcgaccgtgcccagggctctgatgtgtctctcacg
gctcctaagggtgagaccctgaaggcaggaaatgggggacattgggactga

KEGG   Desmodus rotundus (common vampire bat): 112314063
Entry
112314063         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112314063
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112314063
   04145 Phagosome
    112314063
  09143 Cell growth and death
   04218 Cellular senescence
    112314063
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112314063
   04612 Antigen processing and presentation
    112314063
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112314063
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112314063
   05330 Allograft rejection
    112314063
   05332 Graft-versus-host disease
    112314063
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112314063
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112314063
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112314063
   05170 Human immunodeficiency virus 1 infection
    112314063
   05168 Herpes simplex virus 1 infection
    112314063
   05163 Human cytomegalovirus infection
    112314063
   05167 Kaposi sarcoma-associated herpesvirus infection
    112314063
   05169 Epstein-Barr virus infection
    112314063
   05165 Human papillomavirus infection
    112314063
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112314063
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112314063
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112314063
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112314063
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 Ig_2 ig
Other DBs
NCBI-GeneID: 112314063
NCBI-ProteinID: XP_024426442
Position
Unknown
AA seq 363 aa
MESRPLLLLLSGALALTQTWAGPHTLRHFGTLLSGLGESQYIGVGYVDDTEVLLFDSNTP
NPRVQPRMPRREQPWLEQEDPEFWAEQTWLWKQCEQISRAKLNNLRDYYNQSKDGFHTFQ
VISGCVVGSDGRFLRGFGHTAYDGTETFTLKLELSPTTEANKTTQITVQRDLFHQDDVEG
WSAYVENTCVHRLRLFLEKRKETLLRTDPPKTHVTHHPISDHEVTLRCWALGFYPADITL
TWQRDGEDLTQDMELVETRPAGDGSFQKWAAVAMPPGEEQRYTCRVQHQALPEPLILRWD
PPPQTTMTTVGIAAAALSLLVAAAAGAVLWRRRHSGKGRERYSQAACSDSSQGSDVSLTA
PKG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggagtcccgaccactgctcctgctgctctcgggggccctggccctgacccagacctgg
gcgggcccacacaccctgagacatttcggcaccttactgtccggactcggggagtcccag
tatatcggggtcggctacgtggacgacacggaggtcttgctgttcgacagcaacaccccg
aacccgagggtgcagccgcggatgccgaggagggagcagccgtggctggagcaagaagac
ccagagttttgggcggagcagacgtggctctggaagcagtgtgaacagatttcccgagca
aagctgaacaacctgcgcgactactacaaccagagcaaggatgggtttcacaccttccag
gtcatttctggctgcgttgtggggtcagacgggcgcttcctccgcgggttcggtcacacc
gcgtacgacggaaccgaaaccttcaccctgaaattggagctgagtcccaccaccgaagcc
aacaagaccacccagatcaccgtgcagcgcgatttgttccatcaggacgatgtggagggt
tggagcgcctacgtggagaacacctgcgtgcaccggcttcgcctgttcctggagaagagg
aaggagacgctgctccgaacagacccgccaaagacacacgtgacccaccaccccatctct
gaccacgaggtcaccctgaggtgctgggccctgggcttctaccctgcggacatcaccctg
acctggcagcgtgatggggaggacctgacccaggacatggagcttgtggagaccaggccc
gcaggggacgggtccttccagaagtgggcggctgtagccatgccccccggggaggagcag
agatacacatgccgtgtgcagcaccaggctctgcctgagcccctgattctgagatgggac
ccccctcctcagaccaccatgaccaccgtgggcatcgctgctgccgccctgagtctcctt
gtagctgctgccgctggagctgtgctgtggaggaggaggcactcaggcaaaggcagggag
agatactctcaggctgcctgcagcgacagttcccagggttctgatgtgtctctcacggct
cctaaggggtga

KEGG   Desmodus rotundus (common vampire bat): 112314064
Entry
112314064         CDS       T05907                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04144  Endocytosis
dro04145  Phagosome
dro04218  Cellular senescence
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04940  Type I diabetes mellitus
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
dro05320  Autoimmune thyroid disease
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112314064
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112314064
   04145 Phagosome
    112314064
  09143 Cell growth and death
   04218 Cellular senescence
    112314064
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112314064
   04612 Antigen processing and presentation
    112314064
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112314064
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112314064
   05330 Allograft rejection
    112314064
   05332 Graft-versus-host disease
    112314064
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112314064
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112314064
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112314064
   05170 Human immunodeficiency virus 1 infection
    112314064
   05168 Herpes simplex virus 1 infection
    112314064
   05163 Human cytomegalovirus infection
    112314064
   05167 Kaposi sarcoma-associated herpesvirus infection
    112314064
   05169 Epstein-Barr virus infection
    112314064
   05165 Human papillomavirus infection
    112314064
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112314064
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
    112314064
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112314064
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dro00537]
 Antigens
  112314064
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 Ig_2 ig GAGBD
Other DBs
NCBI-GeneID: 112314064
NCBI-ProteinID: XP_024426443
Position
Unknown
AA seq 363 aa
MEPRPLLLMLSGALALTQTWAGPHTLTLSGTLLSGLGESQYIGVAYVDDTEIVRYDTNTP
NARVQPRVPWLESPWVEQEYPDMWEEQKRICKQCEQICRAKLNNLRHYYNQSEDGFHNFQ
VTSACVVGSDRSFLRGYSHTAYDGTETFTLNLDLSSTTEAKKTTQITVQRDLFHQDDVEG
WSAYVENTCVHWLRLFLEKGKETLLRADPPKTHVTHHPISDHEVTLKCWALGFYPSDITL
TWQRDGEDLTQDMEFVETRPAGDGTFQKWAAVAMPPGEEQRYTCRVQHQALPEPLTLRWD
PPPQTTMTTVGIAAAALGLLGAAATGAVLWRRRRSGKGRERYSQAACSDSAQGSDVSLTG
PKG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggagccccgaccgctgctcctgatgctctcgggggccctggccctgacccagacctgg
gcgggcccacacaccctgacactttccggcaccttactgtccggactcggggagtcccag
tacattggggtcgcctacgtggacgacacggagatcgtgcggtacgacaccaacaccccg
aacgcgagggtgcagccgcgagtgccatggttggagagcccgtgggtggagcaggagtat
ccagatatgtgggaggagcagaagcgaatctgcaagcagtgtgaacagatttgccgagca
aagctgaacaacctgcgccattactacaaccagagcgaggacgggtttcacaacttccag
gttacttctgcctgcgttgtggggtcggaccggagcttcctaagagggtacagtcacacc
gcgtacgacggaaccgaaaccttcaccctgaacttggacctaagttccacgaccgaagcc
aagaagaccacccagatcaccgtgcagcgcgatttgttccatcaggacgatgtggagggt
tggagcgcctacgtggagaacacctgcgtgcactggctccgcctgttcctggagaagggg
aaagagacgttgctccgagcagaccctccaaagacacacgtgacccaccaccctatctct
gaccatgaggtcaccctgaagtgctgggccctgggcttctacccttcggacatcaccctg
acctggcagcgtgacggggaggacctgacccaggacatggagtttgtggagactaggcct
gcgggggatggaaccttccagaagtgggcagccgtggccatgccccctggggaggagcag
agatacacatgccgcgtacagcaccaggctctgcctgagcccctgaccctgagatgggac
ccccctcctcagaccaccatgaccaccgtgggcatcgctgctgccgccctgggtctcctt
ggagctgcagccactggagctgtgctgtggaggaggaggcgctcaggcaaaggcagggag
agatactctcaggctgcctgcagcgacagtgcccagggctctgatgtgtctctcacaggt
cctaaggggtga

DBGET integrated database retrieval system