KEGG   Desmodus rotundus (common vampire bat): 112297824
Entry
112297824         CDS       T05907                                 

Gene name
RASGRP3
Definition
(RefSeq) ras guanyl-releasing protein 3
  KO
K12362  RAS guanyl-releasing protein 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04662  B cell receptor signaling pathway
dro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112297824 (RASGRP3)
   04014 Ras signaling pathway
    112297824 (RASGRP3)
   04015 Rap1 signaling pathway
    112297824 (RASGRP3)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112297824 (RASGRP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112297824 (RASGRP3)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_1 EF-hand_8 RasGEF_N
Other DBs
NCBI-GeneID: 112297824
NCBI-ProteinID: XP_024408410
Position
Unknown
AA seq 691 aa
MGSSGLGKAATLDELLSTCIEMFDDNGELNNSCLPRIVLLMHRWYLSSTELAEKLLCMYR
NASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYENHISLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDRLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRADVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRRAFADCEGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSPTSPTTPTKPVVPLEWASGVMPKPDPTVINKHI
RKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKEEMMAYFLRA
KSQLHCKMGPGFVHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLV
LACRRFARAPSLGSGNGSLPGSPSLPPAQDEVFEFPGVTAGHQDLDSRAITLVTGSSRKI
SVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMRSKFHDKAAKDKGFAKWENEKPRVQ
AGVDVVDRGTEFDSDQDEADMGETRQDGEDG
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggggtccagtggacttgggaaagcagcaacattagatgaactgctgagcacttgcatt
gagatgtttgatgacaatggagagctgaataatagttgtttgccaagaatagttctactg
atgcaccgatggtatttatcttccactgaattggcagaaaaacttctctgcatgtatcga
aatgccagtggagaaagctgtgatgaatttcgattaaagatctgctacttcatgaggtac
tggattctgaaatttcctgcagagtttaatttggaccttgggttgatccgtatgactgaa
gaattccgagaagtagctagccaactaggatatgaaaaccacatcagcctcatcgacatt
tccagcataccttcctatgattggatgagaagagtcacacagaggaaaaaagtatccaag
aagggaaaagcctgtctgctctttgaccgtctggagcccattgaattggctgagcacctc
acttttctggagcataaatcttttagaaggatctcattcactgattaccaaagctatgtc
atccatggctgcctggagaataacccaaccttggagagatctattgctttatttaatgga
atctctaagtgggtccagttgatggttcttagcaaaccaaccccccagcaaagggcagat
gtcatcacaaagtttatcaatgttgccaagaagctccttcagctcaaaaattttaacacc
ctgatggcagtggtggggggcctcagtcacagttccatttcacgcctcaaagagacccat
tctcacctttcttcagaagttacaaagaactggaatgaaatgacagagctcgtctcctcc
aacggcaattactgcaattaccgcagggcctttgctgactgtgagggcttcaaaatcccc
atccttggcgtgcacttgaaagacttgatagccgtccacgtcattttcccagactggacg
gaggagaacaaagtgaacattgtgaaaatgcaccagctctccgtcaccctgagtgaactg
gtctccctgcagaacgcctcccaccacctggagcccaacatggacttgatcaacctgctc
acgctttcactggacctctaccacacagaagatgatatttataaactgtcgctggtgctg
gagcctagaaattctaaatcgcctacctcccctacaacgcccaccaagcctgtggtgccc
ctggagtgggcatcaggagtgatgccaaagccagaccccaccgtcatcaacaagcatata
aggaaattagttgagtccgtgtttagaaactatgaccatgaccatgatgggtacatctcc
caggaggactttgaaagtatagctgccaattttcccttcttggattccttctgtgtgctg
gacaaagatcaggatggcctaattagtaaagaagaaatgatggcttacttcctgagagcc
aagtcccaactacattgtaaaatgggaccaggctttgtccataattttcaggagatgacc
tatctcaagccaaccttctgcgaacactgtgcaggatttctctggggaataatcaagcaa
ggatacaaatgcaaagactgtggagccaattgtcacaagcagtgcaaagacctcctggtt
ctggcctgcaggagatttgcccgggccccctccttgggcagtggcaatgggtcgctgccc
ggaagcccctcattgcccccagcacaggatgaggtgttcgagttccctggcgtcactgct
ggacaccaggacctggacagcagagccatcacactggttacaggctcttctcgcaagatc
tccgtgaggctgcagcgggccaccaccagccaggccacccagaccgagcctgtatggtca
gaggctggctggggagactcagggtcccacaccttccccaaaatgagatccaagttccat
gacaaagcagcaaaggacaaaggcttcgccaagtgggaaaacgaaaagcccagggtacaa
gctggcgtggatgttgttgaccggggcaccgagtttgactctgaccaggatgaagcagac
atgggtgagaccagacaggatggtgaggatggctga

DBGET integrated database retrieval system