KEGG   Desmodus rotundus (common vampire bat): 112297858
Entry
112297858         CDS       T05907                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04114  Oocyte meiosis
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04720  Long-term potentiation
dro04724  Glutamatergic synapse
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro05010  Alzheimer disease
dro05014  Amyotrophic lateral sclerosis
dro05020  Prion disease
dro05031  Amphetamine addiction
dro05152  Tuberculosis
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112297858 (PPP3R1)
   04310 Wnt signaling pathway
    112297858 (PPP3R1)
   04370 VEGF signaling pathway
    112297858 (PPP3R1)
   04020 Calcium signaling pathway
    112297858 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    112297858 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112297858 (PPP3R1)
   04218 Cellular senescence
    112297858 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112297858 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    112297858 (PPP3R1)
   04660 T cell receptor signaling pathway
    112297858 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    112297858 (PPP3R1)
   04659 Th17 cell differentiation
    112297858 (PPP3R1)
   04662 B cell receptor signaling pathway
    112297858 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112297858 (PPP3R1)
   04921 Oxytocin signaling pathway
    112297858 (PPP3R1)
   04924 Renin secretion
    112297858 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    112297858 (PPP3R1)
   04720 Long-term potentiation
    112297858 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    112297858 (PPP3R1)
   04380 Osteoclast differentiation
    112297858 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112297858 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112297858 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    112297858 (PPP3R1)
   05020 Prion disease
    112297858 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    112297858 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112297858 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112297858 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    112297858 (PPP3R1)
   05163 Human cytomegalovirus infection
    112297858 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112297858 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112297858 (PPP3R1)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     112297858 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 112297858
NCBI-ProteinID: XP_024408469
Position
Unknown
AA seq 160 aa
MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ
QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtgctcacactttgatgctgatgaaattaaaaggctaggaaagagatttaagaagctt
gatttggacaattctggttctttgagtgtggaagagttcatgtctctgccagagttacaa
cagaaccctttagtacagcgagtaatagatatatttgacacggatgggaatggagaggta
gactttaaagaatttattgagggagtctctcagttcagtgtcaaaggtgataaggagcag
aagttgaggtttgccttccggatctatgacatggataaagatggctatatttccaatggg
gaactcttccaggtgctgaagatgatggtggggaacaatctgaaagatacacagttacag
caaattgtagacaaaaccataataaatgcagataaggatggagatggaagaatatccttt
gaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatggtggtagatgtg
tga

KEGG   Desmodus rotundus (common vampire bat): 112304508
Entry
112304508         CDS       T05907                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04114  Oocyte meiosis
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04720  Long-term potentiation
dro04724  Glutamatergic synapse
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro05010  Alzheimer disease
dro05014  Amyotrophic lateral sclerosis
dro05020  Prion disease
dro05031  Amphetamine addiction
dro05152  Tuberculosis
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112304508 (PPP3R2)
   04310 Wnt signaling pathway
    112304508 (PPP3R2)
   04370 VEGF signaling pathway
    112304508 (PPP3R2)
   04020 Calcium signaling pathway
    112304508 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    112304508 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112304508 (PPP3R2)
   04218 Cellular senescence
    112304508 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112304508 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    112304508 (PPP3R2)
   04660 T cell receptor signaling pathway
    112304508 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    112304508 (PPP3R2)
   04659 Th17 cell differentiation
    112304508 (PPP3R2)
   04662 B cell receptor signaling pathway
    112304508 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112304508 (PPP3R2)
   04921 Oxytocin signaling pathway
    112304508 (PPP3R2)
   04924 Renin secretion
    112304508 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    112304508 (PPP3R2)
   04720 Long-term potentiation
    112304508 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    112304508 (PPP3R2)
   04380 Osteoclast differentiation
    112304508 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112304508 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112304508 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    112304508 (PPP3R2)
   05020 Prion disease
    112304508 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    112304508 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112304508 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112304508 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    112304508 (PPP3R2)
   05163 Human cytomegalovirus infection
    112304508 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112304508 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112304508 (PPP3R2)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     112304508 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 112304508
NCBI-ProteinID: XP_024415900
Position
Unknown
AA seq 170 aa
MGNEASYPTEMCSHFDHDEIKRLGKRFKKLDVDSSGALSVDEFMSVPELQKNPLVQRVIE
VFDTDGNGEVDFEEFIVGTSQFSVKGDEEQKLRFAFSIYDMDRDGYISNGELFQVLQMMV
GDNLKDWKLQQLVDKTIITLDRDGDGKISFEEFRAAVGGLEVHKQLVAVV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggccagctaccccacggagatgtgctcccactttgaccatgatgaaatt
aaaaggttgggcaagaggtttaagaagttggacgtggactcttcgggcgccctgagcgtg
gacgagttcatgtccgtgcccgaactgcagaagaacccgttggtgcagcgagtgatcgag
gtttttgacaccgacggcaacggagaggtggacttcgaggaattcattgtggggacctcc
cagttcagtgtcaagggagatgaggagcagaaactgaggttcgctttcagcatctacgac
atggacagagacggctacatctccaacggggagctcttccaggtgctgcagatgatggtg
ggggacaacctgaaagactggaagctacagcagctcgtggacaaaaccatcatcaccctg
gacagggacggcgacgggaaaatatcctttgaggagttcagagccgccgtggggggcttg
gaagtgcacaagcagttggtggcagttgtgtga

KEGG   Desmodus rotundus (common vampire bat): 112305248
Entry
112305248         CDS       T05907                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04114  Oocyte meiosis
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04720  Long-term potentiation
dro04724  Glutamatergic synapse
dro04728  Dopaminergic synapse
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro05010  Alzheimer disease
dro05014  Amyotrophic lateral sclerosis
dro05020  Prion disease
dro05031  Amphetamine addiction
dro05152  Tuberculosis
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112305248 (PPP3CC)
   04310 Wnt signaling pathway
    112305248 (PPP3CC)
   04370 VEGF signaling pathway
    112305248 (PPP3CC)
   04020 Calcium signaling pathway
    112305248 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    112305248 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112305248 (PPP3CC)
   04218 Cellular senescence
    112305248 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112305248 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    112305248 (PPP3CC)
   04660 T cell receptor signaling pathway
    112305248 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    112305248 (PPP3CC)
   04659 Th17 cell differentiation
    112305248 (PPP3CC)
   04662 B cell receptor signaling pathway
    112305248 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112305248 (PPP3CC)
   04921 Oxytocin signaling pathway
    112305248 (PPP3CC)
   04924 Renin secretion
    112305248 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    112305248 (PPP3CC)
   04728 Dopaminergic synapse
    112305248 (PPP3CC)
   04720 Long-term potentiation
    112305248 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    112305248 (PPP3CC)
   04380 Osteoclast differentiation
    112305248 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112305248 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112305248 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    112305248 (PPP3CC)
   05020 Prion disease
    112305248 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    112305248 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112305248 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112305248 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    112305248 (PPP3CC)
   05163 Human cytomegalovirus infection
    112305248 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112305248 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112305248 (PPP3CC)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112305248 (PPP3CC)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     112305248 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 112305248
NCBI-ProteinID: XP_024416749
Position
Unknown
AA seq 525 aa
MSGRNLHLSTTERVVKAVPFPPTQRLTLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLFLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMDTFDC
LPLAALLNQQFLCVHGGMSPEITCLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGSEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDEIEGGTTVRKEIIKNKIRAIGKMARVFSILREESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAQEAIRGFSLQHRIRSFEEARGLDRINERMPPR
KDSQYLDGPGKSATPVQSNTAHRSDKGRKASKDSEPRCGTGGSKT
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtccgggaggaacctccacctctccaccaccgagcgcgttgtcaaagctgtccccttt
cctccaacccaacggctgactttgaaggaagtgtttgagaatgggaaacctaaaattgac
gtcctgaaaaaccacttggtgaaggaagggcgactggaggaggaagtcgccctaaagata
atcaacgatggagctgccatcctgagacaagagaagacgatgatagaagtagatgctcct
atcacggtgtgtggtgacattcacggacaattctttgacctgatgaagttgtttgaagtc
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagcatagagtgtgtactgtttttatggagtttaaagattaatcatcccaagacattg
tttctgcttcggggaaatcatgaatgcaggcatcttacagaatatttcaccttcaaacag
gaatgtcggatcaaatattcagaacaggtgtatgatgcatgtatggatacatttgactgt
cttcctcttgctgccctattaaatcagcagtttctgtgtgtgcatggagggatgtcacct
gaaattacttgtttagatgacattaggaaattagacaggtttaaagaacctccagccttt
gggccggtgtgtgacctgctttggtccgatccctcagaggactatggcagtgaaaagacc
ttggagcactatacccacaacactgtccgaggctgctcttacttttacagttaccctgca
gtttgtgaatttttgcagaataataatttgttatcaataatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccagacaacaggcttcccgtcactcattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttaaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggacgttttcacgtggtctttgcccttcgttggagaaaaagtcacagagatg
ctggtgaacattctcaacatatgctctgatgatgagttgatttccgatgatgaaattgaa
ggaggcactacagtgcgaaaggagatcatcaagaataaaatcagagccattgggaagatg
gcccgggtcttttcaattcttcgggaagaaagtgagagtgtgctgaccctcaagggcctg
actcctacaggcacactccctctgggtgtcctctcaggaggaaagcagactattgagaca
gccacggtagaagcggtagaggcccaggaagccatcagagggttttcgcttcagcacagg
atccggagttttgaagaagcccgaggtctggaccgaatcaatgagcggatgccaccccga
aaagatagccagtaccttgatgggcctgggaaatcggcgaccccagtacaatcaaacacc
gcacacaggagcgacaagggcagaaaagccagtaaggactcggagccccgctgtggtaca
ggtggatccaagacataa

KEGG   Desmodus rotundus (common vampire bat): 112305449
Entry
112305449         CDS       T05907                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04114  Oocyte meiosis
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04720  Long-term potentiation
dro04724  Glutamatergic synapse
dro04728  Dopaminergic synapse
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro05010  Alzheimer disease
dro05014  Amyotrophic lateral sclerosis
dro05020  Prion disease
dro05031  Amphetamine addiction
dro05152  Tuberculosis
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112305449 (PPP3CB)
   04310 Wnt signaling pathway
    112305449 (PPP3CB)
   04370 VEGF signaling pathway
    112305449 (PPP3CB)
   04020 Calcium signaling pathway
    112305449 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    112305449 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112305449 (PPP3CB)
   04218 Cellular senescence
    112305449 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112305449 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    112305449 (PPP3CB)
   04660 T cell receptor signaling pathway
    112305449 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    112305449 (PPP3CB)
   04659 Th17 cell differentiation
    112305449 (PPP3CB)
   04662 B cell receptor signaling pathway
    112305449 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112305449 (PPP3CB)
   04921 Oxytocin signaling pathway
    112305449 (PPP3CB)
   04924 Renin secretion
    112305449 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    112305449 (PPP3CB)
   04728 Dopaminergic synapse
    112305449 (PPP3CB)
   04720 Long-term potentiation
    112305449 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    112305449 (PPP3CB)
   04380 Osteoclast differentiation
    112305449 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112305449 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112305449 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    112305449 (PPP3CB)
   05020 Prion disease
    112305449 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    112305449 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112305449 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112305449 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    112305449 (PPP3CB)
   05163 Human cytomegalovirus infection
    112305449 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112305449 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112305449 (PPP3CB)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112305449 (PPP3CB)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     112305449 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 112305449
NCBI-ProteinID: XP_024416912
Position
Unknown
AA seq 489 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDERLIYGNKKV
GSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQS
ATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQPDGFNSLNTAHATEN
HGTGNHSAQ
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggatgggatacctagggttgatgttctgaagaaccacttagtaaaagaaggtcgggta
gatgaagaaattgcacttagaattatcaatgagggtgctgccatccttcggagagagaag
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctg
aagattctatacccaagcacattatttcttctgagaggcaatcatgaatgcagacacctt
acggaatattttacctttaaacaggaatgtaaaattaaatattcagaaagagtctatgaa
gcttgtatggaagcttttgatagcctgcctcttgctgcacttttaaaccaacaatttctt
tgtgttcatggtggactttcaccagaaatccacacacttgatgatattaggagattagat
agattcaaagagccacctgcatttggaccaatgtgtgacttgttatggtccgatccttct
gaagattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgt
tcttatttttataactacccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacagtttaactgt
tctccacatccttactggttgcccaattttatggatgtcttcacatggtctttaccattt
gttggagaaaaagtgacagaaatgttggtaaatgttctaagtatttgctctgatgatgaa
ctgatgactgaaggtgaagaccagtttgatgaacggctcatatatggcaataaaaaagta
ggttcagctgcagcccggaaagaaatcataagaaacaaaattcgagcaattggcaagatg
gcaagggtcttctctgttctcagggaggaaagtgaaagtgtgctgacactcaagggcctg
actcccacagggatgttgcctagtggagtgttggctggaggacggcagaccctgcaaagt
gccacagttgaggctattgaggctgaaaaagcaatacgaggattctctccaccacataga
atctgcagttttgaagaggcaaagggtttggatagaatcaatgagagaatgccaccccgg
aaagatgctgtacagccagatggtttcaattctctgaacaccgcacatgccactgagaac
cacgggactggcaaccatagtgcccagtga

KEGG   Desmodus rotundus (common vampire bat): 112317863
Entry
112317863         CDS       T05907                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04114  Oocyte meiosis
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04720  Long-term potentiation
dro04724  Glutamatergic synapse
dro04728  Dopaminergic synapse
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro05010  Alzheimer disease
dro05014  Amyotrophic lateral sclerosis
dro05020  Prion disease
dro05031  Amphetamine addiction
dro05152  Tuberculosis
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112317863 (PPP3CA)
   04310 Wnt signaling pathway
    112317863 (PPP3CA)
   04370 VEGF signaling pathway
    112317863 (PPP3CA)
   04020 Calcium signaling pathway
    112317863 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    112317863 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112317863 (PPP3CA)
   04218 Cellular senescence
    112317863 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112317863 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    112317863 (PPP3CA)
   04660 T cell receptor signaling pathway
    112317863 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    112317863 (PPP3CA)
   04659 Th17 cell differentiation
    112317863 (PPP3CA)
   04662 B cell receptor signaling pathway
    112317863 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112317863 (PPP3CA)
   04921 Oxytocin signaling pathway
    112317863 (PPP3CA)
   04924 Renin secretion
    112317863 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    112317863 (PPP3CA)
   04728 Dopaminergic synapse
    112317863 (PPP3CA)
   04720 Long-term potentiation
    112317863 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    112317863 (PPP3CA)
   04380 Osteoclast differentiation
    112317863 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112317863 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112317863 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    112317863 (PPP3CA)
   05020 Prion disease
    112317863 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    112317863 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112317863 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112317863 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    112317863 (PPP3CA)
   05163 Human cytomegalovirus infection
    112317863 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112317863 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112317863 (PPP3CA)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112317863 (PPP3CA)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     112317863 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 112317863
NCBI-ProteinID: XP_024430726
Position
Unknown
AA seq 511 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtaaaagct
gtcccatttcctccaagtcaccggcttacagcaaaagaagtatttgataacgatgggaaa
cctcgagtggatatcttaaaggcacatctcatgaaggagggcaggttggaagagagtgtt
gcattgagaataataacagagggggcttcaattcttcgacaggaaaaaaatttgctggat
atcgatgcaccagtcactgtttgtggggacatccatggacaattctttgacttgatgaag
ctctttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttactccgaggaaatcatgaatgcagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgtgtctacgacgcctgtatggac
gcctttgactgcctgcccctggccgccctgatgaaccagcagttcctgtgtgtgcacggc
gggctgtccccagagatcaacactttagatgacatcagaaaattagaccgattcaaagag
ccacctgcttatggacctatgtgcgacatcctgtggtcagaccccctggaagactttggc
aatgagaagactcaggaacacttcactcacaacacagtcaggggatgttcgtacttctac
agttacccggccgtttgtgaattcttacagcacaataacttgttatctatactccgagcc
catgaagcccaggatgcagggtatcgcatgtacaggaaaagccaaacaacaggcttccct
tctctaattacgattttctccgcaccaaattacttagatgtgtacaataacaaagctgca
gtattgaagtatgagaacaacgtcatgaacatcaggcagttcaactgttctcctcacccg
tactggcttccaaatttcatggatgtgttcacgtggtctctgccattcgttggggagaaa
gtgactgagatgctggtaaatgttcttaacatctgctcagatgatgaactagggtcggaa
gaagatggatttgatggagccacagctgcagcccggaaggaagtgataaggaacaagatc
cgagcaataggcaaaatggccagagtgttctccgttctcagagaagagagtgagagcgtg
ctgacgctgaaaggcctgacgcccaccggcatgctccccagcggagtgctctctggaggg
aagcagaccctgcaaagcgctatcaaaggattttcaccacagcataagatcaccagcttc
gaggaggccaagggcttagaccgaattaacgagaggatgccgcctcgcagagacgccatg
ccctctgatgccaaccttaactccatcaacaaggctcttgcctcagagactaacggcacg
gacagcaatggcagtaatagcagcaatattcagtga

DBGET integrated database retrieval system