KEGG   Desmodus rotundus (common vampire bat): 112297946
Entry
112297946         CDS       T05907                                 

Gene name
EPAS1
Definition
(RefSeq) endothelial PAS domain-containing protein 1
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro05200  Pathways in cancer
dro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:dro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112297946 (EPAS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112297946 (EPAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112297946 (EPAS1)
   04131 Membrane trafficking [BR:dro04131]
    112297946 (EPAS1)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112297946 (EPAS1)
Membrane trafficking [BR:dro04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    112297946 (EPAS1)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 HLH Corona_I PLD_C
Other DBs
NCBI-GeneID: 112297946
NCBI-ProteinID: XP_024408623
Position
Unknown
AA seq 870 aa
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSIKDGSGFGKKSKDLSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNHCAPPSGLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELVGYHPEELLGRSAYEFYHALDSESMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMAMNSIFDNSGEVAVSEKSHFLYTKLKEEPEELAQLAPTAGDAIISLDFGNQN
FKESSAYGETILPPGQPWAEELRSHGAQSEAGSLPAFTMPQVAVPGNTSPSATNSSCSTP
NSPEDYYTTLNDDLKIEVIEKLFAMDTEAKDQCSPQVDFSELDLETLAPYIPMDGEDFQL
SPICPEEKLLPENPQLLPQQCFSTMTNIFQPLAPMAPHGPCLLDKYQQPLESKKIEPEHQ
PLSSIFYDGGSKVSLPQCCGQASAPLSSLGGRFNTQWPPDPPLHFRPAKWPVSGDQRTEA
LGASPLGAPVTSPHLSMFKKRSAKGFGPQGPDVLSPAVVALSNKLKLKRQLEYEEQAFQD
MSGGDPPGSSPSHLMWKRMKILRGCGNCPSMPDKQLSANIPSDEFTQNPMRGSSQPLRHL
PPPQPPSAMSPRESAKSTFPPQCCAFQYQDYGLPSAHKAAGAASRLLGPSFEPYLLPELT
RYDCEVNVPVPGSSTLLQGGELLRALDQAT
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgacagctgacaaggagaagaaaaggagtagctcggaaaggaggaaggagaagtcccgg
gatgcagcaaggtgccggagaagcaaggagacagaggtcttctacgagctggcgcatgag
ctgcccctgcctcacagcgtgagctcccatctggacaaggcctccatcatgcggctggcc
atcagcttcctgcggacacacaagctcctgtcctcagtttgctctgaaaacgagtctgag
gctgaggccgaccagcagatggacaacctgtacctgaaagccttggagggtttcatcgcc
gtggtgacccaagacggtgacatgatctttctgtcggaaaacatcagcaagttcatggga
ctcacacaggtggagctaacaggacacagtatttttgactttactcatccctgtgaccat
gaggagatccgcgagaacctgagtatcaaggacggctctggttttgggaagaaaagcaaa
gacctgtccacagagcgggacttcttcatgaggatgaagtgcacagtgaccaacaggggc
cgaaccgtcaacctcaagtcagccacctggaaggtcttgcactgcaccggccaggtgaag
gtctacaaccactgcgcccctcccagtggtctctgcggctacaaggagcccctgctctcc
tgcctcatcatcatgtgcgaacccatccagcacccgtcccacatggacatccccctggac
agcaagaccttcctgagccgccacagcatggacatgaagttcacctactgcgacgacaga
atcacagaactggtcggttaccacccagaggagctacttggccgctcagcctatgagttc
taccacgcactggactcagagagcatgaccaaaagtcaccagaacctgtgcaccaagggt
caggtggtgagtggccagtaccggatgctggcgaagcatgggggctacgtgtggctggag
acgcaggggacggtcatctacaaccctcgcaacctgcagccccagtgcatcatgtgtgtg
aactacgtcctgagtgagattgagaagaatgacgtggtgttctccatggaccagacagaa
tccctgttcaagccacacctgatggccatgaacagcatctttgacaacagtggtgaggtg
gctgtttctgagaagagtcacttcctgtacaccaagctgaaggaggagccggaggagctg
gcccagctggcccccactgcgggagatgccatcatttctctggattttgggaaccagaat
ttcaaggagtcatcagcctatggcgagaccatcctgccccccgggcagccatgggctgag
gagttgaggagccacggtgcccagagcgaggccgggagcctgcccgccttcaccatgccc
caggtggctgtgccagggaacaccagccccagtgccaccaacagcagctgctccacgccc
aacagccctgaagactattacacgactctgaacgatgatctgaagattgaagtgattgag
aagctcttcgccatggacacagaggcaaaggaccagtgcagcccccaggtggatttcagt
gagctggacttggagacgctggcaccctacatccccatggacggggaagacttccagctg
agtcccatctgcccggaggagaagctcttgcccgagaaccctcagctcctcccccagcag
tgcttcagtaccatgacaaacatcttccagccgctggcccccatggctccccacggcccc
tgcctcctggacaagtaccagcagccactggagagcaagaagatagagcctgagcaccag
cccctatcctccatcttttatgatggcgggagcaaggtgtccctgccacagtgctgcggc
caggccagcgctcctctctcttctttggggggcagattcaacacacagtggccccctgac
ccaccattacacttcaggcccgcgaagtggcctgtcagcggagatcagcgcactgaggcc
ctgggggcatcgccgttgggggcccctgtcacctcgcctcatctctccatgttcaagaag
aggtctgcgaagggctttgggcctcaaggcccggacgtgctgagcccagccgtggtcgcc
ctctccaacaagctgaagctgaagcgacaactggagtacgaggagcaagccttccaagac
atgagtgggggggaccctccaggcagcagcccttcacatttgatgtggaaaaggatgaag
attctcaggggctgtggaaactgcccttcgatgcccgacaagcagctgagtgcaaacatc
cccagtgatgagttcacccaaaatcccatgaggggctcaagtcagcctctgagacacctg
ccaccaccacagcccccgtccgccatgagccccagggagagcgccaagagcacgttcccc
ccacaatgttgcgcatttcagtaccaagactatggcctgccgtcagctcacaaggctgca
ggtgcggcaagccggctgctcgggccctcgtttgagccctacctgctgcccgaactgacc
agatatgactgtgaggtgaacgtccctgttccaggaagctccacactcctgcaaggaggg
gagcttctcagagccctggaccaggccacttga

DBGET integrated database retrieval system