KEGG   Desmodus rotundus (common vampire bat): 112298050
Entry
112298050         CDS       T05907                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dro03036]
    112298050 (ANKRD53)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    112298050 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3
Other DBs
NCBI-GeneID: 112298050
NCBI-ProteinID: XP_024408729
Position
Unknown
AA seq 522 aa
MKLAQKVSTQLTWTNSQSKHPSPERGLGPSGTLRNGRFLLAPPPVSAGPASCLTDGLAHA
GPRSAIASSNHSSFPPHPRAVASLVSEWDQRDVGSYSELFAAALGNLEWLRFCLNLDHGE
IPTDNKGFTAIHFAAQSGKLECLQVLVEEYKFPVDLPTNNGQTPLHLVIRKENKTMVLPC
IHYLLKHGAALNTQTCNGSTPLHLAAREGLLSCVKVLVTNGANAHARDAVGCKPIDYCKI
RNHRVCARFLKDAMWKQDKKDFACEMGKLKKLKGRLALMEQDYLTEHQKEHQILREADFK
KWLHRKLLPQGQSLMHNTEQEPQAPPWTIPLSKTPKPSKSFHPSLEMRLQQIPQTELQPL
VTPTPVYKKPTVRRPKLWDISNNPVRSPATQIGYPQSIRLGVHPDPSPEHDFHGFLEVRS
DGRGGARLRTVAGKQVAPVPRLPLEVIVRELYPQVRPCRMKVPQGFHPVCMRDVARKRYL
GDNTFWTDTLAMNLRETFDEAFLAAVRAHQGLPIVPSPQPLS
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgaagctggctcagaaagtctccacgcagctcacctggacaaactctcagtccaaacac
cccagtcccgaaaggggcttggggccctcggggacgctcaggaatggccgcttcctcctt
gccccgccgccggtcagtgctggcccagcctcatgcttaactgacggccttgcccacgcg
ggaccaagatctgccattgcttcctccaatcactcctcctttcctccccacccccgcgct
gtggctagcctggtcagtgagtgggaccagagggatgtggggagctattccgaattgttc
gcagctgccttgggcaacctggaatggttgcggttctgcctgaatctggaccatggggaa
atccccacagataacaaggggttcactgccatccactttgcagcccaaagcggcaagctt
gaatgcctgcaggtcttggtagaggagtacaagtttcctgtggacctgcccaccaacaat
ggccagacaccactgcacctcgtcatccgcaaggaaaacaagaccatggtcctcccctgc
atccactatctgcttaagcacggggcagccctcaacactcagacatgcaacggctccacg
cccctgcacctggcggcccgggagggcctgctgagttgtgtgaaggtcctggtgacgaac
ggcgccaatgcccatgcccgagatgccgtgggctgcaagcccatcgactactgcaaaatc
cggaaccaccgcgtctgtgctcggttcctgaaggatgccatgtggaaacaggacaagaag
gactttgcctgtgaaatggggaaactgaagaagctcaaaggccggctggccctcatggaa
caggattacctgactgagcatcagaaagaacaccaaattctgagagaagctgatttcaag
aagtggctccaccgcaaactactgccccaaggccaatctctgatgcacaacactgagcaa
gagccccaagccccaccctggaccatccccctctccaaaacccccaaaccttccaagagc
ttccacccctccctggagatgcgcctacaacagataccacagactgaactgcagcctttg
gtgacacccacacctgtctacaagaagcccacagtcaggcggcccaagttgtgggatatt
agcaacaaccctgtcagatcccccgcaacccagattggctacccgcagagcatccgtctg
ggtgtgcatccagaccctagcccagagcatgacttccacgggttccttgaggtcaggtct
gatgggcgtggtggtgcacgtttgcgcacagtggctggcaagcaggtggcacctgtgcct
cggctgcctttggaggtgatagtccgagagctgtaccctcaagtgcggccatgcaggatg
aaggtgccccagggcttccaccctgtctgcatgagggacgtggcccggaagcggtacttg
ggtgacaacaccttctggaccgacacactggccatgaacctgcgtgagacatttgacgaa
gccttcctggcagcagtgcgagctcatcaagggctccccattgtgccctccccccaaccc
ctctcataa

DBGET integrated database retrieval system