KEGG   Desmodus rotundus (common vampire bat): 112298939Help
Entry
112298939         CDS       T05907                                 

Definition
(RefSeq) L-xylulose reductase-like
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00040  Pentose and glucuronate interconversions
dro01100  Metabolic pathways
Module
dro_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    112298939
Enzymes [BR:dro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     112298939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short NAD_binding_10 Epimerase ADH_zinc_N HEM4 DUF1776
Motif
Other DBs
NCBI-GeneID: 112298939
NCBI-ProteinID: XP_024409825
Position
Unknown
AA seq 233 aa AA seqDB search
MRPEAASIGRSTVQALHAAGVQVVAVSRTQGDLDSLVRECPGVKPVCVDLGDWEATERAL
AGVGPVDLLVNNAAVALLQPFLEVTKEACDISFDVNLRAVIQVSQIVARSLMARGAPGSI
VNVSSQASQRAIHNHTVYCATKGAMDMLTKVMALELGPHKIRVNAVNPTVVMTAMGKANW
SDPQKSKTMLDRIPLGRFAEVENVVDAILFLLSDRSSMTTGSTVPVDGGFLAT
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctgaggcggccagcatcggacgaagcacggtccaggcgctgcacgcggcgggt
gtgcaggtggtggccgtgagcaggacccagggcgacctggacagcctggtccgcgagtgc
cccggggtgaagcctgtgtgtgtggacctgggtgactgggaggccacggagcgggcgctg
gctggcgtgggccccgtggacctgctggtgaacaacgctgccgtggcgctgttgcagccc
ttcctggaggtcaccaaggaggcgtgtgacatctccttcgacgtgaacctgcgggctgtt
atccaggtgtcccagatcgtggctcggagcctgatggcgcgcggggccccagggtccatt
gtcaatgtgtccagccaggcctcccagcgtgccatccacaaccacaccgtctactgtgcc
accaagggcgccatggacatgctgaccaaagtgatggctctggagctggggccacacaag
atccgtgtgaatgcagtgaaccccaccgtggtgatgacagccatgggcaaggcgaactgg
agtgatccccagaagtccaagaccatgctggaccgcatcccgctgggcaggtttgctgag
gtggagaacgtggtggatgccatcctcttcctgctgagtgaccgcagcagcatgaccacg
ggctccacggtgccagtggacgggggcttcctggccacctga

DBGET integrated database retrieval system