KEGG   Desmodus rotundus (common vampire bat): 112299448
Entry
112299448         CDS       T05907                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04670  Leukocyte transendothelial migration
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04750  Inflammatory mediator regulation of TRP channels
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04930  Type II diabetes mellitus
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05017  Spinocerebellar ataxia
dro05020  Prion disease
dro05100  Bacterial invasion of epithelial cells
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05142  Chagas disease
dro05146  Amoebiasis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112299448 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112299448 (PIK3CD)
   04014 Ras signaling pathway
    112299448 (PIK3CD)
   04015 Rap1 signaling pathway
    112299448 (PIK3CD)
   04370 VEGF signaling pathway
    112299448 (PIK3CD)
   04630 JAK-STAT signaling pathway
    112299448 (PIK3CD)
   04668 TNF signaling pathway
    112299448 (PIK3CD)
   04066 HIF-1 signaling pathway
    112299448 (PIK3CD)
   04068 FoxO signaling pathway
    112299448 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    112299448 (PIK3CD)
   04072 Phospholipase D signaling pathway
    112299448 (PIK3CD)
   04071 Sphingolipid signaling pathway
    112299448 (PIK3CD)
   04024 cAMP signaling pathway
    112299448 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    112299448 (PIK3CD)
   04152 AMPK signaling pathway
    112299448 (PIK3CD)
   04150 mTOR signaling pathway
    112299448 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112299448 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    112299448 (PIK3CD)
   04218 Cellular senescence
    112299448 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112299448 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    112299448 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112299448 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112299448 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    112299448 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    112299448 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    112299448 (PIK3CD)
   04660 T cell receptor signaling pathway
    112299448 (PIK3CD)
   04662 B cell receptor signaling pathway
    112299448 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    112299448 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    112299448 (PIK3CD)
   04670 Leukocyte transendothelial migration
    112299448 (PIK3CD)
   04062 Chemokine signaling pathway
    112299448 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112299448 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    112299448 (PIK3CD)
   04929 GnRH secretion
    112299448 (PIK3CD)
   04915 Estrogen signaling pathway
    112299448 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    112299448 (PIK3CD)
   04917 Prolactin signaling pathway
    112299448 (PIK3CD)
   04926 Relaxin signaling pathway
    112299448 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    112299448 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    112299448 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112299448 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112299448 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    112299448 (PIK3CD)
   04722 Neurotrophin signaling pathway
    112299448 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112299448 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    112299448 (PIK3CD)
   04380 Osteoclast differentiation
    112299448 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    112299448 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    112299448 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112299448 (PIK3CD)
   05206 MicroRNAs in cancer
    112299448 (PIK3CD)
   05205 Proteoglycans in cancer
    112299448 (PIK3CD)
   05203 Viral carcinogenesis
    112299448 (PIK3CD)
   05230 Central carbon metabolism in cancer
    112299448 (PIK3CD)
   05231 Choline metabolism in cancer
    112299448 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112299448 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112299448 (PIK3CD)
   05212 Pancreatic cancer
    112299448 (PIK3CD)
   05225 Hepatocellular carcinoma
    112299448 (PIK3CD)
   05226 Gastric cancer
    112299448 (PIK3CD)
   05214 Glioma
    112299448 (PIK3CD)
   05221 Acute myeloid leukemia
    112299448 (PIK3CD)
   05220 Chronic myeloid leukemia
    112299448 (PIK3CD)
   05218 Melanoma
    112299448 (PIK3CD)
   05211 Renal cell carcinoma
    112299448 (PIK3CD)
   05215 Prostate cancer
    112299448 (PIK3CD)
   05213 Endometrial cancer
    112299448 (PIK3CD)
   05224 Breast cancer
    112299448 (PIK3CD)
   05222 Small cell lung cancer
    112299448 (PIK3CD)
   05223 Non-small cell lung cancer
    112299448 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112299448 (PIK3CD)
   05017 Spinocerebellar ataxia
    112299448 (PIK3CD)
   05020 Prion disease
    112299448 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112299448 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112299448 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    112299448 (PIK3CD)
   04931 Insulin resistance
    112299448 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112299448 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112299448 (PIK3CD)
   05135 Yersinia infection
    112299448 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    112299448 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112299448 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    112299448 (PIK3CD)
   05162 Measles
    112299448 (PIK3CD)
   05164 Influenza A
    112299448 (PIK3CD)
   05161 Hepatitis B
    112299448 (PIK3CD)
   05160 Hepatitis C
    112299448 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    112299448 (PIK3CD)
   05163 Human cytomegalovirus infection
    112299448 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112299448 (PIK3CD)
   05169 Epstein-Barr virus infection
    112299448 (PIK3CD)
   05165 Human papillomavirus infection
    112299448 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112299448 (PIK3CD)
   05142 Chagas disease
    112299448 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112299448 (PIK3CD)
   01524 Platinum drug resistance
    112299448 (PIK3CD)
   01522 Endocrine resistance
    112299448 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112299448 (PIK3CD)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112299448 (PIK3CD)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112299448 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 112299448
NCBI-ProteinID: XP_024410467
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWTSEENQNVAVDFLLPTGVYLNFSVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLV
IGKGLHEFDSLCDPEVNDFRAKMRQFCEEAATRRQQLGWEAWLQYCFPLQLEPSARTWGA
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPTPQVQKPR
TKPPPIPMKKPSSASLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLTLFDYKDQLKTGEYCLYMWPSVPDEKGELLNPTGTVCSNPNTESAAALVICLPEVAP
SPVYYPALDKILELGRHGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEIQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDSSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMRVLMKQGEALSKLKALNDFVKVSSQKTPKPQAKELMHVCMR
QEAYLEALSHLQSPLDPSILLAEVCVEQCTFMDSKMKPLWVMYCNEEAGSNGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGETLDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgcccccgggggtggactgccccatggaattctggaccagcgaggagaatcagaacgtg
gcggttgacttcctgctgcccacaggggtctatctgaacttctccgtgtcccgaaatgcc
aacctcagcactatcaagaaggtgttgtggcaccgagcccagtatgagccgctcttccac
atgctcagtgaccccgaggcctatgtgttcacctgcgtcaaccagaccgcggagcagcag
gagctggaggacgagcagcggaggctctgcgacatccagcctttcctgccggtcctgcgc
ctggtggcccgcgagggtgacagggtaaagaagctcatcaactcgcagatcagcctcgtc
attggcaaaggcctgcatgagtttgattctttgtgcgacccggaagtgaatgactttcga
gccaagatgcgccagttctgcgaggaggcagccacccgccggcagcagctgggctgggag
gcctggctgcagtattgcttccccctgcagctggagccctctgcaaggacctggggagcg
ggcaccctgcgggtccccaaccgggccctcctggtcaacgtcaagtttgagggcagtgag
gagagcttcaccttccaggtgtccaccaaggacgtgcccctggccctgatggcctgtgcc
ctccggaagaaggccacagtgttccggcaacctctggtggagcagcctgaggactacacc
ctgcaggtgaacggcaagcacgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggctgaccccccacctgaccatggtgcactcctcc
tccatcctggccatgcgggacgaacagagcaaccccaccccccaggtccagaaaccgcgc
accaaaccgccccccattcccatgaagaagccctcctccgcgtccctgtggtccctggaa
cagcccttctgcattgagctgattcagggcagcaaagtgaacgctgacgagaggatgaag
ctggtggtgcaggccgggctctttcacggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtctggaagcagcgcctggagttcgacatcaac
atctgcgacctgccgcgcatggctcgtctctgctttgcgctgtacgccgtgatcgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcaccctgtttgactacaaggaccagctcaagactggagaatactgcctctac
atgtggccctccgtcccagacgagaaaggggagctactgaaccccacggggaccgtatgc
agcaaccccaacaccgagagcgctgccgcccttgtcatctgtcttccggaggtggccccc
tcccctgtgtactaccctgccctggacaagatcctggagctggggcggcacggggaacat
gggcgcttcaccgaggaggagcagctgcagcttcgggagatcctggagcggcgtgggtct
ggggagctgtacgagcatgagaaggacctggtgtggaagatgcgccacgagatccaggag
cacttccctgaggcgctggcccggctgctgctggtcaccaagtggaacaagcatgaggac
gtggcccagatgctctacctgctgtgctcctggccggagctgcctgtgctgagcgccctg
gagctgctggactccagcttccccgaccggcacgtgggctccttcgccatcaagtccctg
cggaaactgacggatgatgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tatgagtcctacctcgactgcgagctgaccaagttcctgctggaccgggccctggccaac
cgcaagatcggccacttcctcttctggcacctccgctctgagatgcacgtgccatcggtg
gccctgcgcttcggcctcatcatggaggcctactgtaggggcagcacccaccacatgagg
gtgctgatgaagcagggagaagcgctgagcaagctgaaggccctgaatgactttgtcaaa
gtgagctcccagaagacccccaagcctcaggccaaggagctgatgcacgtgtgcatgcgc
caagaggcctacctggaggccctgtcccacctgcagtccccactggacccgagcatcctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagccgctgtgg
gtcatgtactgcaacgaggaggcgggcagcaacggcagcgtgggcatcatctttaagaac
ggggacgacctccgccaggacatgctgaccctgcagatgatccagctcatggacgtgctg
tggaagcaggaggggttggacctcaggatgacgccctacggctgtctctccaccggggac
cgcacaggcctcatcgaggtggtgctgcactctgacaccattgccaacatccagctgaac
aagagcaacatggcagccacggccgctttcaacaaggacgccctgctcaactggctgaag
tccaagaaccctggggagactctggacagagccattgaggagttcaccctgtcctgcgcc
ggctactgcgtggccacgtacgtgctgggcattggcgatcggcacagcgacaacatcatg
atccgagagaatgggcagctgttccacattgattttggccactttctggggaacttcaag
accaagtttggaatcaaccgtgagcgagtcccgttcatcctcacctatgactttgtccac
gtgattcagcaggggaagactaataatagtgagaaatttgaaaggttccgcggctactgc
gagagagcctacaccatcctgagacgccacgggctgctcttcctgcacctcttcgccctg
atgcgcgcggcgggcctgcccgagctcagctgctccaaagacatccagtacctcaaggac
tcgctggcgctggggaagacggaggaggaggcgctgaagcacttccgcgtgaagttcaac
gaagccctccgcgagagctggaagaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

KEGG   Desmodus rotundus (common vampire bat): 112305224
Entry
112305224         CDS       T05907                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04670  Leukocyte transendothelial migration
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04750  Inflammatory mediator regulation of TRP channels
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04930  Type II diabetes mellitus
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05017  Spinocerebellar ataxia
dro05020  Prion disease
dro05100  Bacterial invasion of epithelial cells
dro05135  Yersinia infection
dro05142  Chagas disease
dro05146  Amoebiasis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112305224 (PIK3R2)
   04014 Ras signaling pathway
    112305224 (PIK3R2)
   04015 Rap1 signaling pathway
    112305224 (PIK3R2)
   04370 VEGF signaling pathway
    112305224 (PIK3R2)
   04630 JAK-STAT signaling pathway
    112305224 (PIK3R2)
   04668 TNF signaling pathway
    112305224 (PIK3R2)
   04066 HIF-1 signaling pathway
    112305224 (PIK3R2)
   04068 FoxO signaling pathway
    112305224 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    112305224 (PIK3R2)
   04072 Phospholipase D signaling pathway
    112305224 (PIK3R2)
   04071 Sphingolipid signaling pathway
    112305224 (PIK3R2)
   04024 cAMP signaling pathway
    112305224 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    112305224 (PIK3R2)
   04152 AMPK signaling pathway
    112305224 (PIK3R2)
   04150 mTOR signaling pathway
    112305224 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112305224 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    112305224 (PIK3R2)
   04218 Cellular senescence
    112305224 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112305224 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    112305224 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112305224 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112305224 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    112305224 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    112305224 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    112305224 (PIK3R2)
   04660 T cell receptor signaling pathway
    112305224 (PIK3R2)
   04662 B cell receptor signaling pathway
    112305224 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    112305224 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    112305224 (PIK3R2)
   04670 Leukocyte transendothelial migration
    112305224 (PIK3R2)
   04062 Chemokine signaling pathway
    112305224 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112305224 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    112305224 (PIK3R2)
   04929 GnRH secretion
    112305224 (PIK3R2)
   04915 Estrogen signaling pathway
    112305224 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    112305224 (PIK3R2)
   04917 Prolactin signaling pathway
    112305224 (PIK3R2)
   04926 Relaxin signaling pathway
    112305224 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    112305224 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    112305224 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112305224 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112305224 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    112305224 (PIK3R2)
   04722 Neurotrophin signaling pathway
    112305224 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112305224 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    112305224 (PIK3R2)
   04380 Osteoclast differentiation
    112305224 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    112305224 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    112305224 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112305224 (PIK3R2)
   05206 MicroRNAs in cancer
    112305224 (PIK3R2)
   05205 Proteoglycans in cancer
    112305224 (PIK3R2)
   05203 Viral carcinogenesis
    112305224 (PIK3R2)
   05230 Central carbon metabolism in cancer
    112305224 (PIK3R2)
   05231 Choline metabolism in cancer
    112305224 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112305224 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112305224 (PIK3R2)
   05212 Pancreatic cancer
    112305224 (PIK3R2)
   05225 Hepatocellular carcinoma
    112305224 (PIK3R2)
   05226 Gastric cancer
    112305224 (PIK3R2)
   05214 Glioma
    112305224 (PIK3R2)
   05221 Acute myeloid leukemia
    112305224 (PIK3R2)
   05220 Chronic myeloid leukemia
    112305224 (PIK3R2)
   05218 Melanoma
    112305224 (PIK3R2)
   05211 Renal cell carcinoma
    112305224 (PIK3R2)
   05215 Prostate cancer
    112305224 (PIK3R2)
   05213 Endometrial cancer
    112305224 (PIK3R2)
   05224 Breast cancer
    112305224 (PIK3R2)
   05222 Small cell lung cancer
    112305224 (PIK3R2)
   05223 Non-small cell lung cancer
    112305224 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112305224 (PIK3R2)
   05017 Spinocerebellar ataxia
    112305224 (PIK3R2)
   05020 Prion disease
    112305224 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112305224 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112305224 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    112305224 (PIK3R2)
   04931 Insulin resistance
    112305224 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112305224 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112305224 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    112305224 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112305224 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    112305224 (PIK3R2)
   05162 Measles
    112305224 (PIK3R2)
   05164 Influenza A
    112305224 (PIK3R2)
   05161 Hepatitis B
    112305224 (PIK3R2)
   05160 Hepatitis C
    112305224 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    112305224 (PIK3R2)
   05163 Human cytomegalovirus infection
    112305224 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112305224 (PIK3R2)
   05169 Epstein-Barr virus infection
    112305224 (PIK3R2)
   05165 Human papillomavirus infection
    112305224 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112305224 (PIK3R2)
   05142 Chagas disease
    112305224 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112305224 (PIK3R2)
   01524 Platinum drug resistance
    112305224 (PIK3R2)
   01522 Endocrine resistance
    112305224 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112305224 (PIK3R2)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112305224 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Tai4 ATG11
Other DBs
NCBI-GeneID: 112305224
NCBI-ProteinID: XP_024416715
Position
Unknown
AA seq 728 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGSERCPQNVGWMPGL
NERTRQRGDFPGTYVEFLGPVTLARPGPRPRGPRPLPARPREGPPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGQDSESLYKPELPAPCTDWSLSDIEQWDSAALADGIKGFLLA
LPAPLVTLEAAAEACRTLREAAGPVGPVLEPPTLPLHRALTLRFLLQHLGRVARRAPAPG
PAVRALGVAFGPLLLGAPPPSLPPPGVAPVGTEPNPDFPALLVEKLLQEHLEEQEVAPPA
LPPKPPKVKPTPAGLANGGTPPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTR
LLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRT
KLEQELRTQALDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNE
TEDQYSLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVV
VDGDTKHCVIYRTATGLGFAEPYNLYGSLKELVLHYQHTSLVQHNDALTVTLAHPVRAPG
PGPPPTAR
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggctggcgctgagggcttccaatatcgggcactgtaccccttccgccgggagcggcca
gaggacctggagctgctgccgggcgacgtgctcgtggtgagccgggcagccctgcaggta
ctgggtgtagccgagggcagcgagcgctgcccgcagaacgtgggctggatgcctggcctc
aatgagcgcactcggcagcgtggtgacttcccgggtacctacgtggagttcctggggcct
gtgaccctggcccggccaggccctcgcccccgcggccctcgcccactgcctgccaggccc
cgagaggggcccccagagccaggcctcacactccctgacctgcctgagcagttctcccca
cctgatgtggctcccccgctcctggtgaagcttgtggaggccattgagcggacagggcag
gacagtgaatccctctacaagcctgagctgccagccccgtgcacagactggtccctgagc
gacatagagcagtgggactcagcagccctggctgatggcatcaagggtttcctgctggcg
ctgcctgcacccctcgtgaccctggaggccgctgccgaggcctgtcgtaccctgcgggag
gccgcggggcccgtagggccagtgctggagcccccgacgctaccactgcaccgcgcgctc
acgctccgcttcctgctccagcacctgggtcgggtggcccggcgcgcccctgccccaggt
cctgctgtgcgagccctgggcgtcgcctttgggcctctgctgctcggtgcgccgcctccc
tcactgcctccgccaggggtcgcacctgtcgggactgagcccaaccctgacttcccagca
ctgctggtggagaagttgcttcaggagcacctggaggaacaggaggtcgcacccccagct
ttgccacctaaaccacctaaggtaaagccgacccctgcagggctagccaatggggggacc
ccaccgccctccctgcaggacgctgagtggtactggggtgacatatccagggaggaggtg
aatgagaaactacgggacacacctgacggcaccttcctggtccgagatgcctccagcaag
attcagggagagtacacgctgaccctcaggaaaggcgggaacaacaagctaattaaggtc
ttccaccgtgatgggcactacggcttctcagagccacttaccttctgctccgtcgtggac
ctcatcacccactaccgccacgagtcactggcccagtacaatgccaaactagacactcgg
cttctgtaccctgtgtccaagtaccagcaggaccagatcgtcaaagaagacagcgtggag
gccgtgggtgcccagctcaaagtgtaccaccagcagtaccaggacaagagccgcgagtac
gaccagctctacgaggagtacacacgcacctcccaggaactgcaaatgaagcgcactgca
atcgaggccttcaatgaaaccatcaagatcttcgaagagcagggccagactcaagagaag
tgcagcaaggaatatctggagcgcttccggcgtgagggcaatgagaaggagatgcagagg
atcctgctgaactcagaacggctgaagtctcgcattgctgagatccatgagagccgcacc
aagctggaacaggagctacggacacaagccttggacaaccgggagattgataagcgcatg
aacagcctgaagccagacctcatgcagctgcgcaagatccgagaccagtacctggtgtgg
ctcacccagaaaggtgcccggcagaagaaaatcaacgagtggttgggaatcaaaaatgag
actgaggaccagtattccctgatggaggatgaggatgacctcccccaccacgaggaacgc
acgtggtatgtgggcaagatcaaccgcacgcaggctgaggaaatgctgagcggcaagcgg
gatggaaccttcctcatccgtgagagcagccagcggggctgctacgcatgctctgtggtg
gtggacggcgacaccaagcactgtgtcatctaccgcacggccactggcttgggctttgca
gagccctacaacctgtatggatcgctgaaggagctggtgctgcattaccagcacacctcc
ctagtgcagcacaatgacgcgctcaccgtcacactggcccaccccgtgcgagcacccggc
cctgggcccccacccacagcccgctga

KEGG   Desmodus rotundus (common vampire bat): 112307667
Entry
112307667         CDS       T05907                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04670  Leukocyte transendothelial migration
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04750  Inflammatory mediator regulation of TRP channels
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04930  Type II diabetes mellitus
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05017  Spinocerebellar ataxia
dro05020  Prion disease
dro05100  Bacterial invasion of epithelial cells
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05142  Chagas disease
dro05146  Amoebiasis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112307667 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112307667 (PIK3CA)
   04014 Ras signaling pathway
    112307667 (PIK3CA)
   04015 Rap1 signaling pathway
    112307667 (PIK3CA)
   04370 VEGF signaling pathway
    112307667 (PIK3CA)
   04630 JAK-STAT signaling pathway
    112307667 (PIK3CA)
   04668 TNF signaling pathway
    112307667 (PIK3CA)
   04066 HIF-1 signaling pathway
    112307667 (PIK3CA)
   04068 FoxO signaling pathway
    112307667 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    112307667 (PIK3CA)
   04072 Phospholipase D signaling pathway
    112307667 (PIK3CA)
   04071 Sphingolipid signaling pathway
    112307667 (PIK3CA)
   04024 cAMP signaling pathway
    112307667 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    112307667 (PIK3CA)
   04152 AMPK signaling pathway
    112307667 (PIK3CA)
   04150 mTOR signaling pathway
    112307667 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112307667 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    112307667 (PIK3CA)
   04218 Cellular senescence
    112307667 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112307667 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    112307667 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112307667 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112307667 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    112307667 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    112307667 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    112307667 (PIK3CA)
   04660 T cell receptor signaling pathway
    112307667 (PIK3CA)
   04662 B cell receptor signaling pathway
    112307667 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    112307667 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    112307667 (PIK3CA)
   04670 Leukocyte transendothelial migration
    112307667 (PIK3CA)
   04062 Chemokine signaling pathway
    112307667 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112307667 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    112307667 (PIK3CA)
   04929 GnRH secretion
    112307667 (PIK3CA)
   04915 Estrogen signaling pathway
    112307667 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    112307667 (PIK3CA)
   04917 Prolactin signaling pathway
    112307667 (PIK3CA)
   04926 Relaxin signaling pathway
    112307667 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    112307667 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    112307667 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112307667 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112307667 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    112307667 (PIK3CA)
   04722 Neurotrophin signaling pathway
    112307667 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112307667 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    112307667 (PIK3CA)
   04380 Osteoclast differentiation
    112307667 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    112307667 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    112307667 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112307667 (PIK3CA)
   05206 MicroRNAs in cancer
    112307667 (PIK3CA)
   05205 Proteoglycans in cancer
    112307667 (PIK3CA)
   05203 Viral carcinogenesis
    112307667 (PIK3CA)
   05230 Central carbon metabolism in cancer
    112307667 (PIK3CA)
   05231 Choline metabolism in cancer
    112307667 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112307667 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112307667 (PIK3CA)
   05212 Pancreatic cancer
    112307667 (PIK3CA)
   05225 Hepatocellular carcinoma
    112307667 (PIK3CA)
   05226 Gastric cancer
    112307667 (PIK3CA)
   05214 Glioma
    112307667 (PIK3CA)
   05221 Acute myeloid leukemia
    112307667 (PIK3CA)
   05220 Chronic myeloid leukemia
    112307667 (PIK3CA)
   05218 Melanoma
    112307667 (PIK3CA)
   05211 Renal cell carcinoma
    112307667 (PIK3CA)
   05215 Prostate cancer
    112307667 (PIK3CA)
   05213 Endometrial cancer
    112307667 (PIK3CA)
   05224 Breast cancer
    112307667 (PIK3CA)
   05222 Small cell lung cancer
    112307667 (PIK3CA)
   05223 Non-small cell lung cancer
    112307667 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112307667 (PIK3CA)
   05017 Spinocerebellar ataxia
    112307667 (PIK3CA)
   05020 Prion disease
    112307667 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112307667 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112307667 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    112307667 (PIK3CA)
   04931 Insulin resistance
    112307667 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112307667 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112307667 (PIK3CA)
   05135 Yersinia infection
    112307667 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    112307667 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112307667 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    112307667 (PIK3CA)
   05162 Measles
    112307667 (PIK3CA)
   05164 Influenza A
    112307667 (PIK3CA)
   05161 Hepatitis B
    112307667 (PIK3CA)
   05160 Hepatitis C
    112307667 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    112307667 (PIK3CA)
   05163 Human cytomegalovirus infection
    112307667 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112307667 (PIK3CA)
   05169 Epstein-Barr virus infection
    112307667 (PIK3CA)
   05165 Human papillomavirus infection
    112307667 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112307667 (PIK3CA)
   05142 Chagas disease
    112307667 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112307667 (PIK3CA)
   01524 Platinum drug resistance
    112307667 (PIK3CA)
   01522 Endocrine resistance
    112307667 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112307667 (PIK3CA)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112307667 (PIK3CA)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112307667 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 Ribosomal_S15
Other DBs
NCBI-GeneID: 112307667
NCBI-ProteinID: XP_024419497
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
SFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSTRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcaaggaagtaccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgtcacccaagaagcagaaagagaa
gaattttttgatgaaacaagacgactttgtgatctacggctctttcaaccctttttaaaa
gtaattgagcctgtaggcaaccgtgaagagaagattctcaatcgagaaattggctttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaagacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaacgtagaatcttcaccagaactgccaaagcac
atatacaataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtaccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctttgtgttttagaatatcagggcaaatacattttgaaagtgtgtggatgtgatgaatac
ttcttagaaaaatatcctctgagtcaatataagtatataagaagctgtataatgctgggg
aggatgcccaatttgatgctgatggctaaggaaagcctttactcgcaactgccaatggac
tctttcacaatgccatcttactccagacgcatctccaccgctacaccgtatatgaatgga
gagacttctacaaaatccctctgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtaaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggagaacccttgtgtgataatgtgaacactcaaagagtaccctgttccaat
cccaggtggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgtctttccatttgttctgttaaaggtcgaaagggtgctaaagaggaacattgt
ccattggcgtggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtgcctcatggattagaagatttgctgaatcctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgtg
tcccgagaagcaggatttagttattcccatgcaggactgagtaccagactagccagagac
aacgaattaagggaaaatgataaagaacagctccgagcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctatggagccacagacactattgtgtgact
atccctgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgcaactacccagatcctatggttcgaggttttgctgttcgatgcctagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgctggtgagatttttactcaaaaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtc
agtcagaggtttggcctacttctggaatcctattgtcgtgcgtgtgggatgtatttgaag
cacctgaacaggcaagttgaggctatggaaaagctcatcaacttaactgacattctcaag
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcagatgcgg
cgaccagatttcatggatgctctgcagggctttctgtctcctctaaatcctgctcatcag
ttaggaaacctcaggcttgaagagtgtcgcattatgtcttctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagacatgctaacacttcaaattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtcg
atcggtgactgtgtgggacttattgaggtggtgagaaattctcacaccatcatgcagatt
cagtgcaaagggggcctgaaaggcgcactgcagttcaacagccacacgctccaccagtgg
ctcaaagacaagaacaaaggagaaatatacgatgcggccattgacctgttcacacgttca
tgtgctgggtattgtgtcgcaaccttcattctgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacagctgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttc
ttgatagtgattagtaaaggagcccaagaatgcacaaaaaccagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacagtcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggactggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Desmodus rotundus (common vampire bat): 112310002
Entry
112310002         CDS       T05907                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04670  Leukocyte transendothelial migration
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04750  Inflammatory mediator regulation of TRP channels
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04930  Type II diabetes mellitus
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05017  Spinocerebellar ataxia
dro05020  Prion disease
dro05100  Bacterial invasion of epithelial cells
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05142  Chagas disease
dro05146  Amoebiasis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112310002 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112310002 (PIK3CB)
   04014 Ras signaling pathway
    112310002 (PIK3CB)
   04015 Rap1 signaling pathway
    112310002 (PIK3CB)
   04370 VEGF signaling pathway
    112310002 (PIK3CB)
   04630 JAK-STAT signaling pathway
    112310002 (PIK3CB)
   04668 TNF signaling pathway
    112310002 (PIK3CB)
   04066 HIF-1 signaling pathway
    112310002 (PIK3CB)
   04068 FoxO signaling pathway
    112310002 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    112310002 (PIK3CB)
   04072 Phospholipase D signaling pathway
    112310002 (PIK3CB)
   04071 Sphingolipid signaling pathway
    112310002 (PIK3CB)
   04024 cAMP signaling pathway
    112310002 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    112310002 (PIK3CB)
   04152 AMPK signaling pathway
    112310002 (PIK3CB)
   04150 mTOR signaling pathway
    112310002 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112310002 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    112310002 (PIK3CB)
   04218 Cellular senescence
    112310002 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112310002 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    112310002 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112310002 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112310002 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    112310002 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    112310002 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    112310002 (PIK3CB)
   04660 T cell receptor signaling pathway
    112310002 (PIK3CB)
   04662 B cell receptor signaling pathway
    112310002 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    112310002 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    112310002 (PIK3CB)
   04670 Leukocyte transendothelial migration
    112310002 (PIK3CB)
   04062 Chemokine signaling pathway
    112310002 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112310002 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    112310002 (PIK3CB)
   04929 GnRH secretion
    112310002 (PIK3CB)
   04915 Estrogen signaling pathway
    112310002 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    112310002 (PIK3CB)
   04917 Prolactin signaling pathway
    112310002 (PIK3CB)
   04926 Relaxin signaling pathway
    112310002 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    112310002 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    112310002 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112310002 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112310002 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    112310002 (PIK3CB)
   04722 Neurotrophin signaling pathway
    112310002 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112310002 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    112310002 (PIK3CB)
   04380 Osteoclast differentiation
    112310002 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    112310002 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    112310002 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112310002 (PIK3CB)
   05206 MicroRNAs in cancer
    112310002 (PIK3CB)
   05205 Proteoglycans in cancer
    112310002 (PIK3CB)
   05203 Viral carcinogenesis
    112310002 (PIK3CB)
   05230 Central carbon metabolism in cancer
    112310002 (PIK3CB)
   05231 Choline metabolism in cancer
    112310002 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112310002 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112310002 (PIK3CB)
   05212 Pancreatic cancer
    112310002 (PIK3CB)
   05225 Hepatocellular carcinoma
    112310002 (PIK3CB)
   05226 Gastric cancer
    112310002 (PIK3CB)
   05214 Glioma
    112310002 (PIK3CB)
   05221 Acute myeloid leukemia
    112310002 (PIK3CB)
   05220 Chronic myeloid leukemia
    112310002 (PIK3CB)
   05218 Melanoma
    112310002 (PIK3CB)
   05211 Renal cell carcinoma
    112310002 (PIK3CB)
   05215 Prostate cancer
    112310002 (PIK3CB)
   05213 Endometrial cancer
    112310002 (PIK3CB)
   05224 Breast cancer
    112310002 (PIK3CB)
   05222 Small cell lung cancer
    112310002 (PIK3CB)
   05223 Non-small cell lung cancer
    112310002 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112310002 (PIK3CB)
   05017 Spinocerebellar ataxia
    112310002 (PIK3CB)
   05020 Prion disease
    112310002 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112310002 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112310002 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    112310002 (PIK3CB)
   04931 Insulin resistance
    112310002 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112310002 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112310002 (PIK3CB)
   05135 Yersinia infection
    112310002 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    112310002 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112310002 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    112310002 (PIK3CB)
   05162 Measles
    112310002 (PIK3CB)
   05164 Influenza A
    112310002 (PIK3CB)
   05161 Hepatitis B
    112310002 (PIK3CB)
   05160 Hepatitis C
    112310002 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    112310002 (PIK3CB)
   05163 Human cytomegalovirus infection
    112310002 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112310002 (PIK3CB)
   05169 Epstein-Barr virus infection
    112310002 (PIK3CB)
   05165 Human papillomavirus infection
    112310002 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112310002 (PIK3CB)
   05142 Chagas disease
    112310002 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112310002 (PIK3CB)
   01524 Platinum drug resistance
    112310002 (PIK3CB)
   01522 Endocrine resistance
    112310002 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112310002 (PIK3CB)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112310002 (PIK3CB)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112310002 (PIK3CB)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4381 Tom37_C DUF4135
Other DBs
NCBI-GeneID: 112310002
NCBI-ProteinID: XP_024422029
Position
Unknown
AA seq 1092 aa
MCFNSIMPPAMADILDIWAVDSQIPSDGPIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQIHNYPMFSLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWIDWLKQTYPPEH
EPSNLENLEDKLYGGKLIVAIHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQISGRLEYVFGDHPLIQFQYIRNCVMNRTLPHFMLVECCKIKKMYEQEMIAI
EAAINRNSSNFPLPLPPKKTRIISHVWENNSPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NASKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSKRIQSRIGKGKRFIGQSLEETSDEELSQY
LLQLVQVLKYEPFLDCALSRFLLERALANRRIGQFLFWHLRSEVHIPAVSIQFGVILEAY
CRGSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDL
QSPLNPCVILSELYVEKCKYMDSKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQ
MLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNK
DALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKNGQLFHIDF
GHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGN
LFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEDEALKQFKQKFDEALRESWTTKVN
WMAHTVRKDYRS
NT seq 3279 nt   +upstreamnt  +downstreamnt
atgtgcttcaattccataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagataccatctgatggccccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaaacagatgttgtgg
aagcagattcacaattacccaatgtttagcctccttatggacattgactcctatatgttt
gcctgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgc
gatgtcagaccttttcttccagttctcaaattagtaacaagaagttgtgacccaggagaa
aaattagactcaaaaattggagtccttataggaaaaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcaaattcagtgaggaaaagatt
cagtcacttgtgggattgtcttggatagactggctaaagcaaacatatccaccagagcat
gaaccatccaaccttgaaaacttagaagataaactttatggaggaaagctcattgtcgct
attcactttgaaaattgccaggatgtgtttagctttcaagtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccagaaacgtttgactattcatgggaaggaagatgaa
gttagtccctatgactatgtgttgcaaattagcgggagattagaatatgtgtttggtgat
cacccactaatccagttccagtatatccggaactgtgtaatgaacaggaccttgccccat
tttatgcttgtggaatgctgcaagatcaagaagatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaactttcctcttcctttaccaccaaagaaaaca
cgaattatttctcatgtttgggaaaataacagccctttccaaattgtcttggtaaaggga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggctggcctttttcatggt
actgaacttctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcatatt
tggaatgaaccactggaatttgatattaatacttgtgacctgccacgaatggctagatta
tgttttgctgtttatgcagttttggataaagtgaaaacgaagaaatcaactaaaacgatt
aatgcctctaaatatcagaccatcaggaaatctgggaaagtgcattatcctgtagcatgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagacataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttattattaccctccctttgacaagattatcgaaaaggcagctgagattgcgagc
agcgatagtgctaatgtatcaagtcggggtggaaaaaagtttcttcctgtactgaaggaa
atcttggacagggatcccttgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgaggcaagattgcagagagaacttcccacagtcactgccaaaattattactgtcgatc
aagtggaataaactcgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccctggagcttctagatttcaactatccagatcagtatgttcgg
gaatatgctgtgggctgcctgcaacagatgagcaaaaggatacagagcagaattggcaaa
ggaaaaagattcattgggcaaagtctggaggaaaccagtgatgaagagctctctcaatat
cttttacaactggtgcaagttttaaaatatgagccttttcttgattgtgccctttctaga
ttcctattagaaagagcacttgctaatcggaggatagggcagttcctgttttggcatctt
aggtcagaagtgcacattcctgctgtctccatacaatttggtgtcatccttgaagcgtac
tgccggggaagcgtagggcacatgaaagtgctatccaagcaggttgaagcactcaacaag
ttaaaaactttaaatagtttaatcaaactgaatgcagtgaagctaaacagagccaaaggg
aaagaggccatgcacacttgtttaaaacagaatgcttaccgggaagccctctctgacctg
cagtcacctctgaacccatgtgtcatcctctcagaactctatgttgaaaagtgtaaatac
atggattctaaaatgaagccattgtggttggtgtacaataacaaggtgtttggtgaagat
tcagtcggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccaa
atgctgcgcttgatggatttactctggaaagaagccggtctggatcttcggatgttgcct
tatggctgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaa
acaattgctgacattcagctcaacagtagcaatgtggctgctgctgcagccttcaataaa
gatgcccttctgaactggcttaaagaatacaactctggggatgacctggaccgagccatt
gaggagtttaccctgtcctgtgctggctactgtgtagcttcctatgtccttgggattggc
gacagacatagtgacaatatcatggtcaaaaaaaacggccagctcttccacattgacttt
ggacatattcttggaaattttaaatctaaatttggtattaaaagggagcgggtgcctttt
attcttacctatgatttcattcatgtgattcaacaaggaaaaacgggaaacacggaaaag
tttggtcggttccgccagtgttgtgaggatgcatatctgattttaagacggcacgggaat
ctcttcatcactctctttgccttgatgctgactgcagggcttcctgaactcacatcagtc
aaggatatacagtatcttaaggactctcttgccttaggaaagagtgaagacgaagcactc
aagcagtttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaac
tggatggcccacacagttcggaaagactacagatcttaa

KEGG   Desmodus rotundus (common vampire bat): 112314466
Entry
112314466         CDS       T05907                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04670  Leukocyte transendothelial migration
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04750  Inflammatory mediator regulation of TRP channels
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04930  Type II diabetes mellitus
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05017  Spinocerebellar ataxia
dro05020  Prion disease
dro05100  Bacterial invasion of epithelial cells
dro05135  Yersinia infection
dro05142  Chagas disease
dro05146  Amoebiasis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112314466
   04014 Ras signaling pathway
    112314466
   04015 Rap1 signaling pathway
    112314466
   04370 VEGF signaling pathway
    112314466
   04630 JAK-STAT signaling pathway
    112314466
   04668 TNF signaling pathway
    112314466
   04066 HIF-1 signaling pathway
    112314466
   04068 FoxO signaling pathway
    112314466
   04070 Phosphatidylinositol signaling system
    112314466
   04072 Phospholipase D signaling pathway
    112314466
   04071 Sphingolipid signaling pathway
    112314466
   04024 cAMP signaling pathway
    112314466
   04151 PI3K-Akt signaling pathway
    112314466
   04152 AMPK signaling pathway
    112314466
   04150 mTOR signaling pathway
    112314466
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112314466
  09143 Cell growth and death
   04210 Apoptosis
    112314466
   04218 Cellular senescence
    112314466
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112314466
   04550 Signaling pathways regulating pluripotency of stem cells
    112314466
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112314466
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112314466
   04620 Toll-like receptor signaling pathway
    112314466
   04625 C-type lectin receptor signaling pathway
    112314466
   04650 Natural killer cell mediated cytotoxicity
    112314466
   04660 T cell receptor signaling pathway
    112314466
   04662 B cell receptor signaling pathway
    112314466
   04664 Fc epsilon RI signaling pathway
    112314466
   04666 Fc gamma R-mediated phagocytosis
    112314466
   04670 Leukocyte transendothelial migration
    112314466
   04062 Chemokine signaling pathway
    112314466
  09152 Endocrine system
   04910 Insulin signaling pathway
    112314466
   04923 Regulation of lipolysis in adipocytes
    112314466
   04929 GnRH secretion
    112314466
   04915 Estrogen signaling pathway
    112314466
   04914 Progesterone-mediated oocyte maturation
    112314466
   04917 Prolactin signaling pathway
    112314466
   04926 Relaxin signaling pathway
    112314466
   04935 Growth hormone synthesis, secretion and action
    112314466
   04919 Thyroid hormone signaling pathway
    112314466
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112314466
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112314466
  09156 Nervous system
   04725 Cholinergic synapse
    112314466
   04722 Neurotrophin signaling pathway
    112314466
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112314466
  09158 Development and regeneration
   04360 Axon guidance
    112314466
   04380 Osteoclast differentiation
    112314466
  09149 Aging
   04211 Longevity regulating pathway
    112314466
   04213 Longevity regulating pathway - multiple species
    112314466
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112314466
   05206 MicroRNAs in cancer
    112314466
   05205 Proteoglycans in cancer
    112314466
   05203 Viral carcinogenesis
    112314466
   05230 Central carbon metabolism in cancer
    112314466
   05231 Choline metabolism in cancer
    112314466
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112314466
  09162 Cancer: specific types
   05210 Colorectal cancer
    112314466
   05212 Pancreatic cancer
    112314466
   05225 Hepatocellular carcinoma
    112314466
   05226 Gastric cancer
    112314466
   05214 Glioma
    112314466
   05221 Acute myeloid leukemia
    112314466
   05220 Chronic myeloid leukemia
    112314466
   05218 Melanoma
    112314466
   05211 Renal cell carcinoma
    112314466
   05215 Prostate cancer
    112314466
   05213 Endometrial cancer
    112314466
   05224 Breast cancer
    112314466
   05222 Small cell lung cancer
    112314466
   05223 Non-small cell lung cancer
    112314466
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112314466
   05017 Spinocerebellar ataxia
    112314466
   05020 Prion disease
    112314466
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112314466
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112314466
   04932 Non-alcoholic fatty liver disease
    112314466
   04931 Insulin resistance
    112314466
   04933 AGE-RAGE signaling pathway in diabetic complications
    112314466
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112314466
   05100 Bacterial invasion of epithelial cells
    112314466
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112314466
   05170 Human immunodeficiency virus 1 infection
    112314466
   05162 Measles
    112314466
   05164 Influenza A
    112314466
   05161 Hepatitis B
    112314466
   05160 Hepatitis C
    112314466
   05168 Herpes simplex virus 1 infection
    112314466
   05163 Human cytomegalovirus infection
    112314466
   05167 Kaposi sarcoma-associated herpesvirus infection
    112314466
   05169 Epstein-Barr virus infection
    112314466
   05165 Human papillomavirus infection
    112314466
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112314466
   05142 Chagas disease
    112314466
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112314466
   01524 Platinum drug resistance
    112314466
   01522 Endocrine resistance
    112314466
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112314466
Membrane trafficking [BR:dro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112314466
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 PI_PP_I DUF5638 DUF4806
Other DBs
NCBI-GeneID: 112314466
NCBI-ProteinID: XP_024426809
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSLSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLLYPVSKYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQYRKEY
IERFRREGNEKEIEQIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDVNRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagctgttacaaatggaatgaaggacagttctctttctctt
caggatgcggaatggtactggggggacatttcaagggaagaggtaaatgacaaattacgg
gacatgccagatggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattat
actctgactttgaggaagggaggcaataataagttaataaagatctatcatcgagatggt
aaatacggcttttctgatcctctgacatttaattcagtggtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgttgtacccagtg
tccaaataccaacaggatcagttggtaaaagaagacaatattgatgctgtaggcaaaaaa
ctgcaggagtaccactctcagtatcaggaaaagagtaaagaatatgacaggctatatgaa
gaatataccagaacatcccaggaaatacagatgaagcggactgcaattgaagcttttaat
gaaacaattaaaatatttgaggagcagtgtcacacacaggaacaatatcgcaaagaatac
attgagcgatttcgtagagaggggaatgaaaaggaaattgaacaaattatgatgaattat
gacaaattgaaatcacggctgggagagattcatgatagcaaaatgcgtctggagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaatagtatcaaacct
gacctgatccagctgcgcaagatccgcgatcaacaccttgtatggctcaatcacaaagga
gtgagacagaagcgcctgaatgcctggctggggatcaagaatgaggatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggttcgtt
gaggatgtcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgacggggaa
gtgaagcactgtgtgatctacagcacggcgcgcggctacggcttcgcagagccctacaac
ctgtacagctcactgaaggagctggtgctgcattaccagcagacgtccctcgtccagcac
aacgactccctcaacgtcaggctagcctaccctgtccatgcacagatgccctcgctctgc
agataa

KEGG   Desmodus rotundus (common vampire bat): 112321016
Entry
112321016         CDS       T05907                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04670  Leukocyte transendothelial migration
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04750  Inflammatory mediator regulation of TRP channels
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04930  Type II diabetes mellitus
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05017  Spinocerebellar ataxia
dro05020  Prion disease
dro05100  Bacterial invasion of epithelial cells
dro05135  Yersinia infection
dro05142  Chagas disease
dro05146  Amoebiasis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112321016 (PIK3R1)
   04014 Ras signaling pathway
    112321016 (PIK3R1)
   04015 Rap1 signaling pathway
    112321016 (PIK3R1)
   04370 VEGF signaling pathway
    112321016 (PIK3R1)
   04630 JAK-STAT signaling pathway
    112321016 (PIK3R1)
   04668 TNF signaling pathway
    112321016 (PIK3R1)
   04066 HIF-1 signaling pathway
    112321016 (PIK3R1)
   04068 FoxO signaling pathway
    112321016 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    112321016 (PIK3R1)
   04072 Phospholipase D signaling pathway
    112321016 (PIK3R1)
   04071 Sphingolipid signaling pathway
    112321016 (PIK3R1)
   04024 cAMP signaling pathway
    112321016 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    112321016 (PIK3R1)
   04152 AMPK signaling pathway
    112321016 (PIK3R1)
   04150 mTOR signaling pathway
    112321016 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112321016 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    112321016 (PIK3R1)
   04218 Cellular senescence
    112321016 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112321016 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112321016 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112321016 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112321016 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    112321016 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    112321016 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    112321016 (PIK3R1)
   04660 T cell receptor signaling pathway
    112321016 (PIK3R1)
   04662 B cell receptor signaling pathway
    112321016 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    112321016 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    112321016 (PIK3R1)
   04670 Leukocyte transendothelial migration
    112321016 (PIK3R1)
   04062 Chemokine signaling pathway
    112321016 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112321016 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    112321016 (PIK3R1)
   04929 GnRH secretion
    112321016 (PIK3R1)
   04915 Estrogen signaling pathway
    112321016 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    112321016 (PIK3R1)
   04917 Prolactin signaling pathway
    112321016 (PIK3R1)
   04926 Relaxin signaling pathway
    112321016 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    112321016 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    112321016 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112321016 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112321016 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    112321016 (PIK3R1)
   04722 Neurotrophin signaling pathway
    112321016 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112321016 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    112321016 (PIK3R1)
   04380 Osteoclast differentiation
    112321016 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    112321016 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    112321016 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112321016 (PIK3R1)
   05206 MicroRNAs in cancer
    112321016 (PIK3R1)
   05205 Proteoglycans in cancer
    112321016 (PIK3R1)
   05203 Viral carcinogenesis
    112321016 (PIK3R1)
   05230 Central carbon metabolism in cancer
    112321016 (PIK3R1)
   05231 Choline metabolism in cancer
    112321016 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112321016 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112321016 (PIK3R1)
   05212 Pancreatic cancer
    112321016 (PIK3R1)
   05225 Hepatocellular carcinoma
    112321016 (PIK3R1)
   05226 Gastric cancer
    112321016 (PIK3R1)
   05214 Glioma
    112321016 (PIK3R1)
   05221 Acute myeloid leukemia
    112321016 (PIK3R1)
   05220 Chronic myeloid leukemia
    112321016 (PIK3R1)
   05218 Melanoma
    112321016 (PIK3R1)
   05211 Renal cell carcinoma
    112321016 (PIK3R1)
   05215 Prostate cancer
    112321016 (PIK3R1)
   05213 Endometrial cancer
    112321016 (PIK3R1)
   05224 Breast cancer
    112321016 (PIK3R1)
   05222 Small cell lung cancer
    112321016 (PIK3R1)
   05223 Non-small cell lung cancer
    112321016 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112321016 (PIK3R1)
   05017 Spinocerebellar ataxia
    112321016 (PIK3R1)
   05020 Prion disease
    112321016 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112321016 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112321016 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    112321016 (PIK3R1)
   04931 Insulin resistance
    112321016 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112321016 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112321016 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    112321016 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112321016 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    112321016 (PIK3R1)
   05162 Measles
    112321016 (PIK3R1)
   05164 Influenza A
    112321016 (PIK3R1)
   05161 Hepatitis B
    112321016 (PIK3R1)
   05160 Hepatitis C
    112321016 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    112321016 (PIK3R1)
   05163 Human cytomegalovirus infection
    112321016 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112321016 (PIK3R1)
   05169 Epstein-Barr virus infection
    112321016 (PIK3R1)
   05165 Human papillomavirus infection
    112321016 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112321016 (PIK3R1)
   05142 Chagas disease
    112321016 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112321016 (PIK3R1)
   01524 Platinum drug resistance
    112321016 (PIK3R1)
   01522 Endocrine resistance
    112321016 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112321016 (PIK3R1)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112321016 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 DUF4201 SH3_2 Laminin_I Lant_dehydr_C FANCI_S2 PI_PP_I Mod_r Exonuc_VII_L
Other DBs
NCBI-GeneID: 112321016
NCBI-ProteinID: XP_024434215
Position
Unknown
AA seq 724 aa
MSAEAYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEAESEQQALVLPDLAE
QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASMDVETVDVQ
VLADAFKRYLLDLPNPVIPVAVYNEMISLAQEVQSSEEYIQLLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQSSSKNLLTARVLSELFSPLLFRFPAASSENTEHLIKVVEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgccgaggcgtatcagtacagagcactgtacgactataaaaaggaacgagaagaa
gacattgacttacacttgggtgatatcttgacggtgaataaggggtctttagtagctctc
ggattcagtgatggacaggaagccaggccagaagaaattggctggttaaatggctacaat
gaaaccacaggggagagaggagactttccaggaacttacgtcgaatacattggaaggaaa
aaaatctcaccgcccaccccaaagccccggccacctcgaccccttcctgttgcaccaggt
tcttcaaaaactgaagcagaaagtgagcagcaagctttggtccttccggatcttgcagaa
cagtttgcccctcctgacattgctccacctcttcttatcaaactagtagaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagcagaa
ttacgacagcttcttgattgtgatgctgcctccatggacgtggaaacagttgatgttcaa
gttttagcagacgccttcaaacgctatctcttggacctgccgaatcctgtcattccagta
gcggtttacaatgagatgatttctttagcccaagaagttcaaagctctgaagaatatatc
cagctgttgaagaagctcattaggtcacctaacatacctcatcagtattggcttacgctt
cagtatttgctaaaacatttcttcaagctctcccaaagctccagcaaaaaccttctgact
gcaagagtgctctctgaacttttcagccctctgcttttcagattcccagcagccagctct
gagaatactgaacacctcataaaagttgtagaaatcttaatctcaacggaatggaacgag
cgacagcctgcaccagcactgcctcctaaaccaccaaaacccactactgtggccaacaac
ggtatgaataacaatatgtccttacaagatgccgagtggtactggggagatatctctagg
gaagaagtgaatgagaaacttcgagacacagctgacgggacctttctggtacgagacgcg
tccactaaaatgcatggtgattatactcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaactct
gtggttgaattaataaaccactaccggaatgaatctctagctcagtacaatcccaagctg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatatcgaagctgtagggaaaaaattacatgaatataacactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaggattatacccgtacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacaatgccagacc
caggagcgctacagcaaagagtacatagaaaagtttaaacgtgaaggcaatgagaaagaa
atacaaaggattatgcataattatgaaaagttaaagtctcgaatcagtgaaattgtggac
agcagaagacgactggaggaagacttgaagaagcaggcagctgagtatcgggagattgac
aaacgcatgaacagcattaaacccgacctcatccaactgagaaagacgagagaccaatac
ttgatgtggttgactcagaaaggtgttcggcagaagaagctgaacgagtggttgggcaat
gaaaacactgaagaccaatattcgctggtggaagatgatgaggatttgccccaccacgac
gagaagacatggaatgtcgggagcagcaaccgaaacaaagctgagaacctgctgcgaggg
aagcgagacggcacttttcttgtccgggaaagcagtaaacagggctgctacgcctgctct
gtggtggtggacggtgaggtgaagcactgcgtcatcaacaaaacggcgaccggctatggc
tttgccgagccctacaacctgtacggctccctgaaagaactggtgctccattaccaacac
acctccctggtgcagcacaacgactccctcaacgtcacactagcctaccccgtgtatgcg
cagcagaggcgatga

DBGET integrated database retrieval system