KEGG   Desmodus rotundus (common vampire bat): 112299901Help
Entry
112299901         CDS       T05907                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112299901 (DOCK8)
Membrane trafficking [BR:dro04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    112299901 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 112299901
NCBI-ProteinID: XP_024410905
Position
Unknown
AA seq 2032 aa AA seqDB search
MTHLNSLDVELAQELGDFTEDNLEVVFTPKECRTLQPSLPEEGVELDPHVRDCVQTYIRD
WLIVNQKHQGSSDICGFKKTGCRKDFHKTLQKQTFESETLECSEHRAQAGPHHLNVLCDV
SGKGPLTACDFDLRSLQPDQRLENLLQSVSAEDFEKKNEEARRTNRQAELFALYPSLDEE
DAVEIRPVPECPKEHLGNRLLVKLLTLKFEIEIEPLFASIALYDVKERKKISENFHCDLN
SDQFKGFLRAHTPSVAPSSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGDCAEPYMVI
KESDGGKSKDKIEKLKHQAESFCQRLGKYRMPFAWAPISIASFFNVSTLDREVTDAESVV
GRGSVGERRTLSQSRRLSERALSLEENGAGSNYKTTTMTISSFYKQEGDRLSDEDLFKFL
ADYKRSSSLQRRVKSIPGLLRLEISLAPEVISCCLTPDLLPVKPFPENRTRPHKEILEFP
IREVYVPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMCGEDPSSAMPVIFGKSSGP
EFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVESLLGY
SWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPVQNPPIKWAEGHKGVFNIEVQA
VSSVHTQDNHLEKFFTLCHSLESQVSFPIRVLDHKISETTLEHELKLSIICLNSSRLEPL
VLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKDQHGRNCLL
ASYVHYVFRLPELQRDLPKSGGPTALPDPRYHTYGRTSAAAVSSKLMQARVMSSSNPDLA
GAHSPADEEVKNIMSSKIADRNCSRMSYYGSGNNDVPSATGTPRTASKKHFHEELALQMV
VSAGMVRETVFKYAWFFFELLVKSMAQYVHNTDKQDNFRRTRFSDRFKDDITTIVNVVTS
EIAALVVKPQKENDQAEKMNISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSAKLNSLPIL
ISMRLEFLRILCSHEHYLNLNLFFMNADTAPVSPCPSISSQNSSSCSSFQDQKIASMFDL
TPEYRQQHFLTGLLFTELAASLDAEGEGVSRVQRKAVSAIHSLLSSHDLDPRCVKPEVKV
KIAALYLPLVGIILDALPQLYDFTAADPRGGKNRTSGSDEEQEGIGAINQNVALAIAGNH
FNLKTNGTMLSSLPYKHYNMLNADTTRNLMICFLWIMKNADQSLIRKWIADLPSMQLNRI
LDLLFICVSCFEYKGKPSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMRRRGPGND
RFSCLSENLRWKKEQTHWRQANEKLDKTKAELDQEALISGNLATEANLIILDMQENIIQA
TSALDCKDSLLGGVLRVLVNSLSCDQSTTYLTHCFATLRALIAKFGDLLFEEEVEQCADL
CQRVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVGKASDFNE
EHLRKSLRTILAYAEEDEAMQTTPFPTQVEELLCNLNSILYDTVKMREFQEDPEMLMDLM
YRIAKSYQTSPDLRLTWLQNMAEKHTKKKCYTEAAMCLVHAAALVAEYLSMLEDHSYLPV
GSVSFQNISSNVLEESAVSEDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYET
VNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDSIISKGHKRMFGTYFRVGFYGSKFGDL
DEQEFVYKEPAITKLPEISHRLEGFYSQCFGAEFVEVIKDSAPVDKTKLDPNKAYIQITF
VEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPY
IKTRICVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGSVGATVNQ
GPLEVAQVFLAEIPADPKFYRHHNKLRLCFKEFIMRCGEAVEKNRRLITADQREYQQELK
KNYDKLKENLRPMIKRKIPELYKPIFRVESQKRDSFHRSSLRKCETQLSQGS
NT seq 6099 nt NT seq  +upstreamnt  +downstreamnt
atgacacacctgaacagtctagatgtggagctggcccaggagctgggggacttcacggaa
gacaacttggaggtggtgttcacaccaaaggaatgtcggactctgcagccctctttgccg
gaggagggagttgaactggaccctcatgtcagggactgtgttcagacctatatccgggac
tggctgattgtgaaccagaaacaccaaggaagttcagacatttgcggttttaaaaagact
ggatgccgaaaagattttcacaagacgcttcagaaacagacgtttgaatcagaaaccttg
gagtgcagtgaacacagagctcaggcaggcccccaccacttaaacgtgctgtgtgatgtg
tctgggaaaggccccctcactgcttgtgacttcgatctccgcagcctgcagccagaccag
cggctggaaaacctcctgcaaagtgtgagtgcggaggacttcgaaaagaagaatgaggag
gcccggaggaccaaccggcaggccgagctctttgccctttacccatccctggacgaggag
gatgctgtggaaatacgtccggttccagaatgtcctaaggaacatctgggcaacaggctg
ttggtcaagttgctgaccctgaagtttgagattgaaattgagcctctatttgccagcatt
gccctctacgatgttaaggaaaggaaaaagatctcagaaaactttcactgtgacctgaac
tctgaccagttcaaaggatttctgcgtgcccacaccccctctgtggccccttcgagtcag
gcaagatctgcggtgttctcagtcacctacccatcttcagacatctacctagtagtcaag
attgaaaaggttctccagcagggagagattggagactgtgcagaaccctacatggtcatc
aaagaaagtgatggtgggaagagtaaagacaagattgaaaaactaaagcatcaagccgaa
tccttctgccagcgtttggggaagtaccgcatgccctttgcctgggctcccataagcata
gcgagcttcttcaatgtctccaccctggacagggaggtaaccgacgcggagtccgtggtt
ggaagaggctctgtgggtgaacggagaaccttgtcccaatctagaaggctttctgaaaga
gccctctccttggaggaaaatggggctggatccaactacaagaccaccaccatgaccata
agcagcttttacaagcaggagggagatcgccttagtgatgaagacttattcaagttttta
gctgactacaagagatcttcatccttacagagaagagtcaagtcaattccaggcttgctc
agactggagatttctctagctccagaggtaatcagttgttgtctgactcctgacctactg
ccagtgaaacccttccctgaaaaccggacacgtccacacaaagagattttggaatttcca
atccgggaggtgtacgtccctcacactgtgtacagaaaccttctctatgtctacccacag
aggctgaacttcgctaacaaactggcatctgcccggaacattacaataaagatccagttt
atgtgtggagaggatcctagcagcgctatgccggttatcttcgggaaatccagtgggcct
gaatttctgcaggaggtgtacacagctgtcacataccataataagtctcctgacttctat
gaagaagtgaaaattaagctccctgccaagctcacagtaaatcaccacctcctgttcacc
ttctatcatatcagttgtcagcagaaacaaggagcctccgtagaaagtctcctgggatac
tcatggctgccaattctcttaaatgaacgtcttcaaactggatcctactgtctcccagtt
gccctggaaaagctgccacccaactactccatgcattctgcagagaaggtccctgtacag
aatcctcccattaagtgggccgaaggacacaagggggtatttaacattgaagtgcaagct
gtttcttccgttcacacccaggacaaccatctggagaagttcttcactctctgccactcc
ttggagagccaggtgtccttccccatccgcgtgctggaccacaagatcagtgagacaacc
ctggagcacgagctgaagctcagcatcatctgcctcaactcctcccgcctggagcctctc
gtgctcttcctgcacctggtgctggacaagctcttccagctgtccgtgcagcccatggtc
atcgctggccagacagccaacttctcccagtttgccttcgagtccgtggtggccatcgcc
aacagcctgcacaacagcaaggacctgagcaaagaccagcacggcaggaactgcctgctg
gcctcctacgtgcactacgtcttccgcctgccggagctgcagagggacttgcccaagtca
ggtggccccactgccctccctgaccctcgctaccacacatatggacgcacgtctgctgct
gctgtgagttcgaagctgatgcaggcccgggtgatgagcagcagtaacccagaccttgcg
ggggcacactctccagcagacgaggaagttaagaacatcatgtcctcaaagatcgccgat
cgcaactgcagccggatgtcttactatggctctggcaataatgatgttccaagtgccacc
ggaaccccaaggacagccagcaaaaagcacttccacgaggagcttgccctgcagatggtg
gtcagcgctgggatggtgagagaaacagtcttcaagtacgcctggttcttctttgagctt
ctggtgaaaagcatggcccagtacgtacacaacacggacaaacaggacaattttcggagg
actcgcttttccgaccgtttcaaagatgacataactaccattgtcaatgtggtcacctcg
gagattgcagcccttgtagtaaagcctcagaaggaaaacgatcaggcggaaaagatgaac
atcagcctggctttcttcttgtatgaccttctctcactcatggatcgtggctttgtgttt
aacctcatcaaacattactgcaaccagctgtcagccaagctgaacagcctcccaatcctc
atctccatgaggctggagttcctgagaatcctctgcagccacgagcattacctcaatctg
aacctcttcttcatgaacgctgacactgcgccagtatctccctgtccctccatatcctcc
cagaactcgagctcctgctccagtttccaggaccagaagattgccagcatgttcgatctg
actccggagtaccgccagcagcacttcctcacggggcttctcttcactgaactggctgct
tccctggatgctgaaggggaaggggtcagcagagtgcaaaggaaagccgtcagtgccatt
cacagcctgctaagttctcacgacctggacccacgctgtgtcaaaccagaggtgaaggtc
aaaattgctgccctttacctgcctttggttggcatcattttggatgctttgccacagctc
tatgactttacagctgcagatccccgtggtggaaaaaaccgcaccagtggttcagatgaa
gaacaagaagggatcggtgcaattaaccagaatgtggcactggccatcgctgggaatcat
tttaatttgaagacaaatggaacaatgctgtcttccctgccctataagcattacaacatg
ctaaatgccgacacaacccgaaacctcatgatctgcttcctctggatcatgaaaaacgca
gaccagagcctcattaggaagtggattgctgacctgccatcgatgcaactcaacaggatt
ttagatctccttttcatctgtgtctcgtgctttgagtacaagggaaagccaagttctgac
aaagtcagcacccaagtcctgcagaagtcgagggatgtcaaggccagactggaagaggct
ttgctccgtggtgaaggggccagaggggagatgatgcggcgccggggtccagggaatgac
cggttttcatgcctaagtgaaaatttgagatggaagaaggagcagacacattggcggcaa
gctaatgagaagctagataaaacaaaggcagagttagatcaagaagccttgatcagtggc
aatctagctacagaagcaaatttaatcatcctggacatgcaggaaaacatcatccaggca
acctccgctttggactgtaaagacagcctgctgggaggtgttctcagagtcctggtgaat
tctctgagctgtgatcagagcaccacctacctgactcactgctttgcaacactccgtgct
ctcattgccaagttcggcgacttgctgttcgaggaggaggtggagcagtgtgcagacctg
tgtcagcgtgtgctgcaccattgcagcagcagcatggatgtcacccggagccaagcctgc
gccaccctctacctcctcatgaggttcagttttggagccaccagtaactttgcaagagta
aagatgcaagtaaccatgtctctggcatctctggtgggcaaagcgtcagactttaatgag
gagcacctgagaaaatccttgaggacgatcttggcctatgcggaagaggacgaggccatg
cagacgacacctttccccacccaggtagaagaactgctctgcaacctgaatagcatccta
tacgacacagtgaaaatgagggaatttcaagaagatcctgagatgcttatggatctcatg
tacagaattgccaagagttaccagacatctccggatctgcggctgacctggctccagaac
atggcagagaaacacaccaagaagaagtgctacacggaggccgccatgtgcctggtgcac
gcagcagccttagtggctgagtacctgagcatgctggaggatcatagctacctgcccgtg
ggcagcgtcagcttccagaacatttcttccaatgtgctggaggaatctgccgtctctgaa
gacaccctgtcgcctgacgaggacggcgtgtgctccggccggtacttcactgagagcggc
ctggtgggcctcctggagcaggcggccgagctcttcagcacgggtggattgtatgagaca
gttaatgaggtctacaaactggtcattcccatcctagaagcacatcgagacttccggaag
ttgacctccactcacgacaagctgcagaaggcctttgacagcatcattagcaagggtcat
aagagaatgtttggaacctacttccgagttggcttttatggatccaaatttggggatttg
gatgaacaagaatttgtttacaaagagcctgcaattaccaagcttcctgagatctctcat
agactagagggattttatagtcaatgttttggtgcagaatttgtggaagtaataaaagac
tctgctcctgtggacaaaaccaagttggaccctaacaaggcttacatacagatcactttt
gtggagccttactttgatgagtacgagatgaaagacagggtaacctactttgagaagaat
ttcaatctgcggaggttcatgtacaccacccccttcactctggaggggcggcctcgtgga
gagctgcacgagcagtaccggcggaacacggtcctaactaccatgcacgccttcccctac
atcaagacccgcatctgcgtcatccagaaggaggagtttgttttgacgccaatcgaagtt
gccattgaagatatgaagaagaagaccctgcagttagcggttgccattaaccaagagccc
cctgatgccaagatgcttcagatggtgctgcagggctccgtgggagcaactgtaaatcag
ggaccactggaagtagcccaagtgtttttggctgaaataccagctgaccccaaattctat
cgacatcacaacaaattgagattatgctttaaggaattcataatgcggtgcggtgaggcc
gtagagaaaaacaggcgcctcatcacagcagaccagagggaataccaacaggaactcaag
aagaactacgacaagctgaaagagaacctcaggcccatgatcaagcggaaaattccagaa
ctctacaaaccaatattcagagttgagagtcaaaagagagactccttccaccgatctagt
ttgaggaaatgtgaaacccagttgtcacagggcagctaa

DBGET integrated database retrieval system