KEGG   Desmodus rotundus (common vampire bat): 112300586
Entry
112300586         CDS       T05907                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00230  Purine metabolism
dro01100  Metabolic pathways
dro01522  Endocrine resistance
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04072  Phospholipase D signaling pathway
dro04114  Oocyte meiosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04261  Adrenergic signaling in cardiomyocytes
dro04270  Vascular smooth muscle contraction
dro04371  Apelin signaling pathway
dro04540  Gap junction
dro04611  Platelet activation
dro04713  Circadian entrainment
dro04714  Thermogenesis
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04727  GABAergic synapse
dro04742  Taste transduction
dro04750  Inflammatory mediator regulation of TRP channels
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04913  Ovarian steroidogenesis
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04921  Oxytocin signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04970  Salivary secretion
dro04971  Gastric acid secretion
dro04972  Pancreatic secretion
dro04976  Bile secretion
dro05032  Morphine addiction
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112300586 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112300586 (ADCY4)
   04371 Apelin signaling pathway
    112300586 (ADCY4)
   04020 Calcium signaling pathway
    112300586 (ADCY4)
   04072 Phospholipase D signaling pathway
    112300586 (ADCY4)
   04024 cAMP signaling pathway
    112300586 (ADCY4)
   04022 cGMP-PKG signaling pathway
    112300586 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112300586 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112300586 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112300586 (ADCY4)
   04062 Chemokine signaling pathway
    112300586 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    112300586 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    112300586 (ADCY4)
   04912 GnRH signaling pathway
    112300586 (ADCY4)
   04913 Ovarian steroidogenesis
    112300586 (ADCY4)
   04915 Estrogen signaling pathway
    112300586 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    112300586 (ADCY4)
   04921 Oxytocin signaling pathway
    112300586 (ADCY4)
   04926 Relaxin signaling pathway
    112300586 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    112300586 (ADCY4)
   04918 Thyroid hormone synthesis
    112300586 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    112300586 (ADCY4)
   04916 Melanogenesis
    112300586 (ADCY4)
   04925 Aldosterone synthesis and secretion
    112300586 (ADCY4)
   04927 Cortisol synthesis and secretion
    112300586 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112300586 (ADCY4)
   04270 Vascular smooth muscle contraction
    112300586 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    112300586 (ADCY4)
   04971 Gastric acid secretion
    112300586 (ADCY4)
   04972 Pancreatic secretion
    112300586 (ADCY4)
   04976 Bile secretion
    112300586 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    112300586 (ADCY4)
   04727 GABAergic synapse
    112300586 (ADCY4)
   04725 Cholinergic synapse
    112300586 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    112300586 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    112300586 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    112300586 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    112300586 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    112300586 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112300586 (ADCY4)
   04714 Thermogenesis
    112300586 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112300586 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    112300586 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    112300586 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112300586 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112300586 (ADCY4)
   05163 Human cytomegalovirus infection
    112300586 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112300586 (ADCY4)
Enzymes [BR:dro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     112300586 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 112300586
NCBI-ProteinID: XP_024411629
Position
Unknown
AA seq 1077 aa
MARLFSTRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLALLVVASASGRDLTSDPG
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWAALLALGQGFLFTGGLVSAWDQV
SFFLFVIFTTYAMLPLGMKEATAAGLVSSLSHLLVLGLYLGPQLDSRPALLPQLAANTVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDVNMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLQEKALASFSPQWSLDRSRTPWGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRTPALAITYSITFLLFLLLLFICFSEHLTRCVLKGPKMLHWLPALSGLVATRP
GLRVALGTATILLIFAMAIASLFFIPATSNCPFRAPNVSSMAFNLSWELPGSLPLISIPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLVARLYQGSLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPKFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQEAQQDAERSCSHLGTMV
EFAVALGCKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQALGYTCYSRGVIKVKGKGQLCTYFLNTDLTRAGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggccagactcttcagtacccggccgccgcccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctcctgctactgctgctggtgatcgtgctctgcgcg
ctcctggccctgcttgtcgttgcctcagccagcggcagggatttgacctcagacccaggc
ttcctgaccacggtgctgtgcgcgctgggtggcttctctctgctactgggcctagcctcc
cgcgagcagcgactgcagcgctggacgcgtcccctgtcgggcctcgtgtgggcagcgctg
ctcgcgctgggccaaggtttcctgttcactgggggcctggtgagcgcctgggaccaggtg
tcctttttcctctttgtcatcttcactacctacgccatgttgcctttgggcatgaaagaa
gccaccgctgcgggtcttgtctcgtcgctctcacacctgctggtcctcgggctgtatctt
gggcctcagctggactcaagacccgcgctgctgccgcagctggcagcaaacacggtgttg
ttcctgtgcgggaatgtggccggagtgtaccacaaggcgttgatggagcgggcactgcgc
gccaccttcagagaggcgcttagttccctgcactctcgccggcggctggacacagagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggcccgagagatgaag
gcagagatcatggcacggctgcaggctggacaggggtcaaggccagagaacaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcggctagccagtgagtgctccccaaaggagttggtgctgatgctcaatgag
ctctttggcaagttcgaccagatcgccaaggagcacgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctccgggctgcccctctccctgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactgcgagcagccaccggt
gtggacgtcaacatgcgtgtgggcgtgcactcaggaagtgtgctctgtggagtcatcggg
ctgcagaagtggcagtatgatgtctggtcccatgatgtcacattagccaaccacatggag
gcgagtggtgtgccaggacgagtgcacatcacaggggctactctggccctgctggcagga
gcttacgctgtggaggatgcagccatggaacaccgggatccatacctgcgggagctaggg
gagcctacctacctggtcattgacccccgggctgaggaggaggatgagaagggcactgca
ggagggttgctgtcctctctcgagggccccaagatgcgtccatcactgctaatgacccgc
tacctggaatcctggggtgcagccaagccttttgcccacctgagccacgttgagagccct
gtgtccacttctactcctctccaggagaaggccctggcttccttcagcccccagtggagc
ctggaccggagccgtacaccctggggactagatgatgaactggacactggagatgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtcaaaggacttc
aacccgctgacactgtacttccgagagaaggaaatggagaaagagtatcgactctctgca
ctccctgccttcaaatactatgcagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctggtgacaaacaggaccccggcgctggccatcacctatagcatcaccttc
ctcctcttcctcctcctcctcttcatctgcttctcagagcacctgacgaggtgtgtcttg
aaaggccccaaaatgctgcactggctgcccgcactgtctggcctggtggccacccggccc
ggactgagagttgccctgggcactgccaccatcctcctcatctttgccatggccattgcc
agcctgttcttcataccagcaacatcgaactgccctttcagggctcccaatgtgtcctcc
atggctttcaacctctcctgggagctccctgggtccctgcctctcatcagcattccatac
tccatgcactgctgtgtgctgggtttcctctcctgctccctctttctgcacatgagcttc
gaactgaagctgctgctgctcctgctatggctggcggcctcctgctccctcttcctgcac
tcccatgcctggctgtctgactgcctcgtcgcccgcctctatcagggctccttggactcc
aggcctggagtgctgaaggagccaaaattgatgggagctatctccttcttcatcttcttc
ttcacactccttgtcttggctcggcagaatgagtactactgccgcctggatttcctgtgg
aagaagaagctgaggcaggagagggaggagacagagacaatggagaatttgactcggctg
ctcttggagaatgtgctccctgcacacgtggcccccaagtttattggccagaaccggcgc
aatgaggacctctaccaccagtcctacgaatgtgtctgtgtcctcttcgcctcagtccca
gacttcaaggagttttactctgagtccaacatcaaccacgaggggctagagtgtctgcgg
ctgctcaatgagatcattgctgattttgatgagctgctctctaagcccaagttcagtggg
gtggagaagatcaaaaccatcggcagcacctacatggcagctacaggcctaaatgccacc
tctggacaggaggcacagcaggatgctgagcgaagctgtagccaccttggcaccatggtg
gaatttgcagtggcccttgggtgtaagctggacgttatcaacaagcactcattcaacaac
ttccgcttgcgtgtggggttgaaccatggacctgtagtggccggagtgataggggcccag
aaaccacaatatgacatctggggcaacacggtgaacgtggccagccgcatggagagtaca
ggagtcctgggcaagatccaagtgacggaggagacggcctgggccctgcaggccttaggc
tacacctgctacagcagaggtgttatcaaggtcaaaggcaaagggcagctgtgcacctac
ttcctgaacacagatttgacacgagctggacctccctcagccaccctaggctga

DBGET integrated database retrieval system