KEGG   Desmodus rotundus (common vampire bat): 112300806
Entry
112300806         CDS       T05907                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04360  Axon guidance
dro04625  C-type lectin receptor signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04921  Oxytocin signaling pathway
dro05135  Yersinia infection
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112300806 (NFATC3)
   04310 Wnt signaling pathway
    112300806 (NFATC3)
   04022 cGMP-PKG signaling pathway
    112300806 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112300806 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112300806 (NFATC3)
   04660 T cell receptor signaling pathway
    112300806 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    112300806 (NFATC3)
   04659 Th17 cell differentiation
    112300806 (NFATC3)
   04662 B cell receptor signaling pathway
    112300806 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112300806 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    112300806 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112300806 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112300806 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112300806 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    112300806 (NFATC3)
   05161 Hepatitis B
    112300806 (NFATC3)
   05163 Human cytomegalovirus infection
    112300806 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112300806 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112300806 (NFATC3)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    112300806 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 112300806
NCBI-ProteinID: XP_024411942
Position
Unknown
AA seq 1077 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLNSPL
CLPHHGLPSHPSVLSPSFQLQGHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQEIDAPEDDLHINDPEKEYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVQGGSGLGPALLPPFQYYVETDIPLKTRKTSEDQATVLPGKLELCS
DDQGSLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSHFTWSKPKPGHTPIFRTSSLPP
LDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQ
MFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAG
ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQEL
PHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIKEKCQGAH
IVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREDIDLASVPSLP
VPHPVQTQRPSSDTGHGCDSVLSAQRSLVCPIQQTYASMVTSSHLPQLQCRDESAGKEQH
MIPSSVMHQPFQVTPTPPVGSSYEPMQTNVYNGPTCLPINAASSQEFVPVLFQQDAALPS
LINLGCQPPSSIPFHSSNSASPGHILTHIPHSVHTLPHLQSMEYHCSNTGQRSLSSPVAD
QVTGQPSPQLQSITYGSSQLGSATTVSPAASHPLAGSPLSGPPSPQLQPMPYQSPSSGTA
SSPTLATRMHSGQHSTQAQSTGQGGLSAPSSLICHNLCDPTSFSSDKATVNIKPEPEEQQ
EPNFSTIGLQDITLDDVNEIIGRDMSQVSVSQGTGVSRQAPLPGPDSLDLGRSLDGL
NT seq 3234 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtcttcggcgag
gacggggcgccggcaccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaactcaccactt
tgcttaccacatcatggattaccgtctcatccttctgttttgtcaccatcgtttcagctc
caaggtcacaaaaactatgaaggaacttgtgagattccggaatctaaatatagcccatta
ggtggtcccaaaccctttgagtgcccaagtattcaaatcacatccatctctcctaactgt
catcaagaaatagatgctcctgaagatgacctacatataaatgacccagaaaaggaatat
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcttaccgggagtct
tcccttagtcctagtcctgccagcagcatctcttctaggagctggttctcagatgcatca
tcttgtgaatctctttcacatatttatgatgatgtggattcagaattgaatgaagctgct
gcccgatttactcttggatcccccctgacttctcctggtggctctccagggggctgccct
ggagaagagtcctggcatcaacagtatggactgggacactccttgtcacccaggcagtct
ccttgccactctcctagatctagtgtcactgatgagaattggctgagtcccagaccagcc
tcaggtccctcatcaaggcctacctccccttgtgggaaacggcggcactctagtgctgag
gtttgttatgctgggtccctttcaccccatcactcacctgttccttctcctggccactcc
cctaggggaagtgtaacagaagatacctggctcaatgcttctgtccaaggtggatcaggc
cttggtcctgcacttcttccaccatttcagtactatgtagagactgatatccctctaaaa
acaaggaagacttctgaagatcaagctactgtactaccaggaaaattagagctctgttca
gatgatcaagggagtttatcaccatctcgggagacttcaatagatgatggccttggatct
cagtatcctttaaagaaagactcatctggtgaccagtttctttcagttccttcacacttt
acctggagcaaacccaagcctggccacacccctatatttcgcacatcttcattacctcca
ctagactggcctttacctactcattttggacaatgtgaactgaaaatagaggtgcaacct
aaaactcatcatcgagcccattatgaaactgaaggtagccgaggagcagtaaaagcatct
actggtggacaccctgttgtgaagctgctgggatacagtgaaaagccgataaatctacag
atgtttattggaacagcagatgatcgatatttacgacctcatgcattttaccaggtgcat
cgaatcactgggaagacagttgctactgcaagccaagagataataattgccagcacaaag
gttctggaaattccacttcttcctgaaaacaatatgtcagccagtattgactgtgccggt
attttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcaga
aagaatactagagtacgacttgtgtttcgcgtgcacatcccacagcccaatggaaaagtc
ctttctctgcagaccgcttctatacctgttgagtgctcccagcggtctgctcaagaactt
cctcatattgaaaagtacagtatcaacagttgttctgtaaatggtggtcatgaaatgatt
gtgactggatctaattttcttccagaatcgaaaatcatttttcttgaaaaaggccaagat
ggacgacctcagtgggaggtagaagggaaaataatcaaggaaaaatgtcaaggggctcac
attgtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcac
ttttatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacacca
gttttgatgaagcaagaacacagagaggacattgacttggcttcagttccatcattgcct
gtacctcatcctgtccagacccagaggccttcctcagatacaggacacggatgtgacagt
gtactgtcagcacagagaagcttggtttgtcccatccagcaaacatatgcatccatggta
acatcatctcatctgccacagttgcagtgtagggatgagagtgctggtaaagaacagcac
atgataccttcttcagtcatgcaccagccttttcaagtcacaccaacacctcctgtgggg
tcttcctatgagcctatgcaaactaatgtatacaatggaccaacttgtcttcctattaat
gctgcctccagtcaagaatttgttccagttttgtttcagcaagatgcagctcttcctagt
ttaataaatcttggctgccaaccaccatcatccataccttttcattcttcaaactcagcc
tcaccaggacatatcttaacccatatacctcattctgtgcataccctgcctcatctgcag
tcaatggaataccattgttcaaacacaggacaaagatctctttcttctccagtggctgac
caggtcacaggccagccttcccctcagttacagtccattacatacggttcttcacaatta
gggtctgctacaacagtttccccagcagcttctcatcccctggccggttcaccactttct
ggacctccgtctcctcagctacagcctatgccttaccaatctcctagctcaggaactgcc
tcatcaccaactctagccaccagaatgcattctggacagcattcaactcaagcacaaagt
acaggtcagggaggtctttctgcaccttcatccttaatatgtcacaatttgtgtgatcca
acttcattttcatctgacaaagcaactgtgaacattaaacctgaacctgaagagcagcag
gaacctaacttttcaacaattggtctacaggacatcactttagatgatgtgaacgagatc
attggaagagacatgtcccaggtttctgtttcccaaggaacaggggtgagcaggcaggct
cccctccctggtcctgattccctggatttaggaagatctcttgacgggctctga

KEGG   Desmodus rotundus (common vampire bat): 112303992
Entry
112303992         CDS       T05907                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04921  Oxytocin signaling pathway
dro05135  Yersinia infection
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112303992 (NFATC2)
   04370 VEGF signaling pathway
    112303992 (NFATC2)
   04022 cGMP-PKG signaling pathway
    112303992 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112303992 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112303992 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    112303992 (NFATC2)
   04660 T cell receptor signaling pathway
    112303992 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    112303992 (NFATC2)
   04659 Th17 cell differentiation
    112303992 (NFATC2)
   04662 B cell receptor signaling pathway
    112303992 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112303992 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    112303992 (NFATC2)
   04380 Osteoclast differentiation
    112303992 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112303992 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112303992 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112303992 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    112303992 (NFATC2)
   05161 Hepatitis B
    112303992 (NFATC2)
   05163 Human cytomegalovirus infection
    112303992 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112303992 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112303992 (NFATC2)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    112303992 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 112303992
NCBI-ProteinID: XP_024415341
Position
Unknown
AA seq 918 aa
MEAPEQQLDPDGRDALGHEPGDSPQEELDFSMLFNYDYMNPPEEEPNAHKVANPHSGLAY
PDDGLDYGLKPYSPLASFSGEPPGRFGEPDRVGPQNFLSPAKPAGASGLSPRIEITPSHE
LMQAGGLRVRDTGLLGEQASLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISD
TFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRP
ASRSSSPGAKRRHSCAGALAAPLPGASPQHSRSPSPQPPDDGPPPGYPPTAGSAVLMDAL
NSLAPDSPCGIPPKMWKTSPDPSPVSAAPPKAGLPRHIYPAMEFLGPCEQEERRNSAPES
ILLMPPTWPKQLVPAIPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHYETE
GSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTT
SYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFR
VHIPESSGRIISLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTAES
KVVFTEKTTDGQQVWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTSVKVNFYVINGKRKR
SQPQHFTYHPVPAIKTEPTDEYDPTLICSPAHGGLGSQPYYPQHPRVAESPSCLVATMAP
CQQFRSGLSSPDARYQQQSPAAVLYQRSKSLSPSLLGYQQPALMTTPLSLTDAHRSVLVH
AGSQGQGSALLHSSPANQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPP
PVSQGQRLSPGSYPTVIQQQNATSQRASKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDD
VNEIIRKEFSGPPTRNQT
NT seq 2757 nt   +upstreamnt  +downstreamnt
atggaagccccggaacagcagctagaccctgacggaagggacgccctgggccacgagcct
ggggacagcccccaagaagagctggacttctccatgctcttcaactatgactatatgaat
cctcctgaagaagaaccgaatgcacataaggtcgccaacccacactccggacttgcgtac
cctgatgatggcctggactatggcctcaagccctacagccccctcgccagtttctctggc
gagccccccggccgattcggagagccggatagggtagggccccagaactttctgagccca
gccaagccagcgggggcctcgggcctgagccctcggatcgagatcactccatcccacgaa
ctgatgcaggcaggggggctccgcgtgagagacactggcctcctgggggagcaggcgtca
ctggcgggggtggccgccagcccgaggttcacgctgcccgtgcccggcttcgagggctac
cgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttccgac
accttctctccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgacctg
tgtccccagtttcaaaacatccctgctcattattcccccagaacctcgccaataatgtca
cctcgaaccagcctcgctgaggacagctgcctgggccgccactcgcccgtgccccgtccg
gcctcccgctcctcgtcgcctggtgccaagcggaggcattcgtgcgccggggccttggct
gctccgctgcccggagcctcgccccagcactcccgcagcccctcgccgcagcccccggac
gacggccccccccctggctaccccccgacggccggctctgccgtcctcatggatgccctg
aacagcctcgccccggactcaccttgtgggatcccccccaagatgtggaagaccagcccg
gacccgtcgccagtgtccgccgccccgcccaaggccggcctgccccgccacatctacccg
gccatggagttcctggggccctgcgagcaggaggagaggagaaactcggcccccgagtcc
atcttgctgatgccgccgacctggcccaagcagctggtgcctgctattcccatctgcagt
atcccagtgaccgcatccctccctccgctggagtggccgctgtcccaccagtcaggctcc
tatgagctgcggattgaggtgcagcccaagcctcatcaccgggcccactatgagacagaa
ggcagccgcggggccgtcaaagctcccaccggtggccaccctgtggttcagctccatggc
tacatggaaaacaagcccctggggctgcagatcttcattgggacagctgacgagcggatc
cttaaaccccacgccttctaccaggtgcaccggatcacgggaaaaaccgtcaccaccacc
agctatgagaagatcgtgggcaacaccaaagtcctggagatcccgctggagcccaaaaac
aacatgagggcgaccatcgactgtgcgggcatcctgaagctgcggaatgcggacatcgag
ctgcgcaagggcgagacggacattggcagaaagaacacacgggtcaggctggttttccgg
gtgcacattccagagtccagtggaaggatcatctccctgcagactgcatcgaaccccatc
gagtgctcccagcgatctgcccacgagctgcccatggtggaaagacaggacatcgacagc
tgcctggtctacgggggccagcagatgattctcaccggacagaacttcacggccgagtcc
aaagtcgtgttcacagagaagaccacagatgggcagcaggtctgggagatggaggccacg
gtggacaaggacaagagccagcctaacatgctgtttgttgagatccctgagtatcggaac
aagcacatccgcacatcggtgaaggtgaacttctacgtcatcaatgggaaaaggaagcga
agtcagcctcagcactttacctaccacccagtcccagccatcaagacggagcccacagat
gaatatgaccccaccttgatctgcagtcctgcccatggaggcctggggagccagccttac
tacccacagcaccccagggtggctgagtccccctcctgcctcgtggccaccatggctccc
tgccagcagttccgctcagggctctcgtcccccgatgcccgctaccagcagcagagccca
gcagctgtcctgtaccaacggagcaagagcctgagccccagcctgctgggctaccagcag
ccggccctgatgacgacccccctgtccctcacggatgcccaccgctctgtgctggtgcat
gctggctcccaaggccaaggctcggccctgctgcactcctcgccggccaaccagcaggcc
tcaccggtgatccactactcgccgaccaaccagcagctgcgctgcgggagccaccaggag
ttccagcacatcatgtactgcgagaatttcgcgcccggcaccaccaggcccggcccgccc
cctgtcagtcaaggtcagaggctgagcccggggtcctaccctacggtcattcaacagcag
aatgccacaagccaaagagcctccaaaaacggacccccggtcagtgaccaaaaggaagta
ttgcctgcaggagtgacaattaaacaggagcagaacttggatcagacctacttggatgac
gttaacgaaattatcaggaaggagttttcaggacctcccaccagaaatcagacgtag

KEGG   Desmodus rotundus (common vampire bat): 112322654
Entry
112322654         CDS       T05907                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04380  Osteoclast differentiation
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04921  Oxytocin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05135  Yersinia infection
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112322654 (NFATC1)
   04310 Wnt signaling pathway
    112322654 (NFATC1)
   04024 cAMP signaling pathway
    112322654 (NFATC1)
   04022 cGMP-PKG signaling pathway
    112322654 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112322654 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112322654 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    112322654 (NFATC1)
   04660 T cell receptor signaling pathway
    112322654 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    112322654 (NFATC1)
   04659 Th17 cell differentiation
    112322654 (NFATC1)
   04662 B cell receptor signaling pathway
    112322654 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112322654 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112322654 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112322654 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    112322654 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112322654 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112322654 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112322654 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    112322654 (NFATC1)
   05161 Hepatitis B
    112322654 (NFATC1)
   05163 Human cytomegalovirus infection
    112322654 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112322654 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112322654 (NFATC1)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    112322654 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 112322654
NCBI-ProteinID: XP_024435982
Position
Unknown
AA seq 928 aa
MTGPEDQEFDFDFLFEFNQSNEGVPGVAPEHQGYTTSTISPGLPLCRAHPALPGPCHDLQ
TPTPGISAAVGHPSGYGAAVDGGPSGYFLPSGHIRPNGAPALESPRIEITSYLGLHHSNS
QFFHDVDVEDVLPSSKRPPSTATLNLPNLEAYRDPSCLSPASSLSSRSCNSEASSYESNY
SYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACSLLGSPRHSPSTSPRTSVTEESWLG
ARGSRPPSPSNKRKYGLDGRQLSCSPHSSPAPSPHGSPRVSVTDDSWLGNTTQYTSSAIV
AAINALSTDSSLDLGDGVPVKARKTALDHSPSVALKVEPAGEDLGTTPPSSDFPPEEFPP
FQHIRKGAFCDQYLSVPQHPYQWARPRSPTSYTSPTLPALDWQLPSRSGPYELRIEVQPK
SHHRAHYETEGSRGAVKASAGGHPSVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVH
RITGKTVSTTSHEAVLSNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIELRKGETDIGR
KNTRVRLVFRVHIPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSAASCPVLGGKRMV
LSGHNFLQDSKVIFVEKAPDGHHIWEMEAKTDRDLCKPNSLVVEIPPFRNQRVTSPVQVS
FYVCNGKRKRSQYQPFTYLPANVPIIKTEPTDDYEPALTCGPMSQGLSPLPKPCYSQQLA
LPPDPGSCLVAGFPPCPQRSALMSPPPSASPKLHDLSSATYSKGMASPSHGPLGLQRPAG
GVLASPEAPRPVGVHPGSPQQPPPTLLQPQVSPQLSSSRSPGGQPALCPHSPSSALPPGA
QEPTCLQPCSPARPPGMGHQQHQLPKVPETESAAPGPLPLPEVCEDSNQGLAPTPVSVKR
EPQELDQLYLDDVNEIIRNDLSSTNTHS
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgacggggccggaggaccaggagttcgactttgatttccttttcgaatttaaccaaagc
aacgaaggcgtccctggcgtggccccagaacatcaaggctacacgacctccaccatcagc
ccaggcctgcccctgtgcagggcacaccccgccctgccgggcccctgccatgacctgcag
acgcccaccccgggcatctcggcggctgtgggccacccctcggggtacggagccgcagtg
gacggcgggccctcgggctactttctgccttccggccacatcaggcccaacggtgccccg
gccctggagagccctcgcatagagatcacgtcctacctggggctgcaccacagcaacagc
cagttcttccacgacgtggacgtggaggacgtcctccccagctccaaacggcccccgtcc
acggccaccctgaacctgcccaacctggaggcctaccgggacccctcctgcctgagcccg
gccagcagcctgtcctcgcgcagctgcaactccgaggcctcgtcctacgagtccaactac
tcgtatccctacgcgtccccgcagacatcgccctggcagtctccctgcgtgtcccccaag
accacggaccctgaggagggcttcccccgcggcctgggggcctgcagcctgctgggctcc
ccgcgccactcgccgtccacctcgccccgcacaagcgtcacggaggagagctggctgggc
gctcgcggctcccggcccccgtcccccagcaacaagaggaagtacggcctggacgggcgg
cagctgtcctgctccccacacagctcgcccgcgccgtccccgcacggctcaccgcgcgtc
agcgtcacggacgacagctggctgggcaacaccacgcagtacaccagctcggccatcgtg
gccgccatcaacgccctgagcaccgacagcagcctggacctgggcgacggcgtccccgtg
aaggcccgcaagaccgccctggaccactcgccctcggtggccctcaaagtggagcccgcg
ggcgaggacctggggaccacgccgccttcctcggacttcccgccggaggagttccccccc
ttccagcacatccgcaagggcgccttctgcgaccagtacctgtccgtgccacagcacccg
taccagtgggcccggcccaggtcccccacgtcctacaccagcccgactctccccgccctc
gactggcagctgccgtcgcgctcgggaccctacgagctgaggatcgaggtgcagcccaag
tcccaccacagagcccactacgagaccgagggcagccgtggcgccgtgaaggcgtcagcg
gggggccaccccagcgtgcagcttcacggctacctggagaatgagcccctcacgctgcag
ctgttcatcgggacagcggacgaccggctgctgcggccacatgccttctaccaggtccac
cgcatcacggggaagacggtctccaccaccagccacgaggccgtcctgtccaataccaag
gtcctggagatcccgctgctgccagagaacaacatgcgcgccatcatcgactgtgccggg
atcctgaagctccggaactcggacatcgagctgcgcaagggggagacggacattggccgg
aagaacacgcgcgtgaggctggtgttccgggtccacatcccgcagcccagcggccgcacg
ctgtctctgcaggtggcctccaaccccatcgagtgctcccagcggtcggcccaggagctg
cccctggtggagaagcagagcgcggccagctgccctgtgcttggcgggaagaggatggtg
ctgtccggccacaacttcctgcaggactccaaagtcatctttgtggagaaagcgccagac
ggccaccacatctgggagatggaggcgaagaccgaccgagacctgtgcaagccgaactcg
ctggtggtcgagataccgcccttccgcaaccagagggtcaccagccccgtccaggtcagc
ttctacgtctgcaacgggaagaggaagcgaagccagtaccagcccttcacctacctgcct
gccaatgttccaatcataaaaacagagcccaccgatgactatgagccggccctgacttgt
ggaccaatgagccagggcctgagcccactcccgaagccgtgttacagccagcagctggcc
ctgccgcccgacccggggtcctgcctcgtggcgggtttcccgccctgtccccagagaagc
gccctgatgtcaccgccacccagtgccagcccgaagctccacgacctgtcctccgccacc
tacagcaagggcatggccagccccagccacggtcccctcggacttcagcggccagccgga
ggggtcctcgccagcccagaggcgccacggcccgtgggcgtgcaccccggctccccccag
cagccgccccccaccctgctgcagccacaggtgagtccacagctgagcagcagccgttcc
ccgggtggccagccagcactctgtccccacagcccctcgtctgcactgccgcccggtgcc
caagagccgacctgtctgcagccctgcagcccagcccgcccacccgggatgggccaccag
cagcaccagctgccgaaggttccggaaacagagtctgcagccccagggcctctgccgctg
cccgaggtgtgtgaggacagtaatcagggtctggcccccactcccgtgtcggtcaagcga
gagcctcaagagttggaccagctgtacctggacgacgtaaatgaaataatacgaaacgac
ctctccagcaccaacacccattcatag

DBGET integrated database retrieval system