KEGG   Desmodus rotundus (common vampire bat): 112301126
Entry
112301126         CDS       T05907                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04218  Cellular senescence
dro04270  Vascular smooth muscle contraction
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04510  Focal adhesion
dro04540  Gap junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04726  Serotonergic synapse
dro04730  Long-term depression
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04912  GnRH signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro04929  GnRH secretion
dro04935  Growth hormone synthesis, secretion and action
dro05010  Alzheimer disease
dro05034  Alcoholism
dro05132  Salmonella infection
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112301126 (RAF1)
   04012 ErbB signaling pathway
    112301126 (RAF1)
   04014 Ras signaling pathway
    112301126 (RAF1)
   04015 Rap1 signaling pathway
    112301126 (RAF1)
   04370 VEGF signaling pathway
    112301126 (RAF1)
   04371 Apelin signaling pathway
    112301126 (RAF1)
   04630 JAK-STAT signaling pathway
    112301126 (RAF1)
   04068 FoxO signaling pathway
    112301126 (RAF1)
   04072 Phospholipase D signaling pathway
    112301126 (RAF1)
   04071 Sphingolipid signaling pathway
    112301126 (RAF1)
   04024 cAMP signaling pathway
    112301126 (RAF1)
   04022 cGMP-PKG signaling pathway
    112301126 (RAF1)
   04151 PI3K-Akt signaling pathway
    112301126 (RAF1)
   04150 mTOR signaling pathway
    112301126 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112301126 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    112301126 (RAF1)
   04218 Cellular senescence
    112301126 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112301126 (RAF1)
   04540 Gap junction
    112301126 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112301126 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112301126 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112301126 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    112301126 (RAF1)
   04660 T cell receptor signaling pathway
    112301126 (RAF1)
   04662 B cell receptor signaling pathway
    112301126 (RAF1)
   04664 Fc epsilon RI signaling pathway
    112301126 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    112301126 (RAF1)
   04062 Chemokine signaling pathway
    112301126 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112301126 (RAF1)
   04929 GnRH secretion
    112301126 (RAF1)
   04912 GnRH signaling pathway
    112301126 (RAF1)
   04915 Estrogen signaling pathway
    112301126 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    112301126 (RAF1)
   04917 Prolactin signaling pathway
    112301126 (RAF1)
   04921 Oxytocin signaling pathway
    112301126 (RAF1)
   04926 Relaxin signaling pathway
    112301126 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    112301126 (RAF1)
   04919 Thyroid hormone signaling pathway
    112301126 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    112301126 (RAF1)
   04916 Melanogenesis
    112301126 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112301126 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    112301126 (RAF1)
   04720 Long-term potentiation
    112301126 (RAF1)
   04730 Long-term depression
    112301126 (RAF1)
   04722 Neurotrophin signaling pathway
    112301126 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    112301126 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112301126 (RAF1)
   05206 MicroRNAs in cancer
    112301126 (RAF1)
   05205 Proteoglycans in cancer
    112301126 (RAF1)
   05230 Central carbon metabolism in cancer
    112301126 (RAF1)
   05231 Choline metabolism in cancer
    112301126 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112301126 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112301126 (RAF1)
   05212 Pancreatic cancer
    112301126 (RAF1)
   05225 Hepatocellular carcinoma
    112301126 (RAF1)
   05226 Gastric cancer
    112301126 (RAF1)
   05214 Glioma
    112301126 (RAF1)
   05221 Acute myeloid leukemia
    112301126 (RAF1)
   05220 Chronic myeloid leukemia
    112301126 (RAF1)
   05218 Melanoma
    112301126 (RAF1)
   05211 Renal cell carcinoma
    112301126 (RAF1)
   05219 Bladder cancer
    112301126 (RAF1)
   05215 Prostate cancer
    112301126 (RAF1)
   05213 Endometrial cancer
    112301126 (RAF1)
   05224 Breast cancer
    112301126 (RAF1)
   05223 Non-small cell lung cancer
    112301126 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112301126 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    112301126 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112301126 (RAF1)
   05152 Tuberculosis
    112301126 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112301126 (RAF1)
   05164 Influenza A
    112301126 (RAF1)
   05161 Hepatitis B
    112301126 (RAF1)
   05160 Hepatitis C
    112301126 (RAF1)
   05163 Human cytomegalovirus infection
    112301126 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112301126 (RAF1)
   05165 Human papillomavirus infection
    112301126 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112301126 (RAF1)
   01522 Endocrine resistance
    112301126 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112301126 (RAF1)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112301126 (RAF1)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112301126 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 112301126
NCBI-ProteinID: XP_024412194
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKEAVFDGPSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDMCQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNVRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggctttggattcaaagaagca
gtgtttgatggccccagctgcatttcccccacaatagttcagcagttcggctatcagcgc
cgagcgtcggatgatggcaaactcacagactcatctaagacaagcaatactattcgtgtt
ttcttgccaaacaagcaaagaacggtggtcaatgtacgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaggtgaggggcctgcagccggagtgctgcgcggtgttcaga
cttctccacgagcacaaaggtaaaaaagcacgtttagattggaacactgatgctgcctcg
ttgattggagaagaacttcaagtagatttcttggatcatgttcccctcacaacacacaac
tttgctcggaagaccttcctaaagcttgccttctgtgacatgtgtcagaagttcctgcta
aatggatttcggtgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatgtcagacaactcttattgtttccaaattccact
attggtgatagtggggtcccagcactgccttctttgacaatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccacgccttcacattc
aacacctccagcccctcctctgaaggttccctctcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagtcacagtgaatcagcctcaccttcagccttgtccagcagccccaacaatctg
agcccaacgggctggtcacagcccaaaacccctgtgccagcacagagagaacgggcacca
ggatctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaggtgatgctttccactcggattgggtcaggctccttt
ggaactgtttataagggcaagtggcacggagatgttgcagtaaagatcctaaaggttgtt
gaccccacacccgagcagttccaggccttcaggaacgaggtggctgtcctgcgtaaaaca
cggcacgtgaacatcttgcttttcatgggctacatgacgaaggacaatctggcgatagtg
acccagtggtgcgaaggcagcagcctctataaacacctgcatgtccaagagaccaagttc
caaatgttccagttgatcgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acagtgaaaattggagattttggtttggcaacagtaaagtcacgctggagtggttctcag
caggttgaacaacccaccggctctatcctgtggatggccccagaggtgatccgaatgcag
gataataaccctttcagcttccagtctgacgtctactcctatggcattgtgctgtatgag
cttatgacaggggagctgccttactcccacatcaacaaccgagaccagatcatcttcatg
gtgggccgggggtatgcctccccagacctcagtaagctgtacaaaaactgccccaaagca
atgaagcggcttgtcgcagactgtgtgaagaaagttaaagaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccaacactctctaccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccacacagaggacatcaacgcctgcacgctgacc
acgtcccccagactgcctgtcttctag

DBGET integrated database retrieval system