KEGG   Desmodus rotundus (common vampire bat): 112301408Help
Entry
112301408         CDS       T05907                                 

Definition
(RefSeq) dedicator of cytokinesis protein 6-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112301408
Membrane trafficking [BR:dro04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    112301408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 112301408
NCBI-ProteinID: XP_024412630
Position
Unknown
AA seq 460 aa AA seqDB search
MAAGSVGSWGRGPGAFLEVVVQGKLEPGVICAPSQTLGPSRSPSPSHPLCPISGVSGPVP
VPLSAGFYPALPPTLLPKVWMRSPEGRGPRAGRSPSSKTVAAEVRKQVSRERSGSPHSSR
RCSSSLGVPLTEVIEPLDFEDVILSRPPDAEPGPLRDLVEFPVDDLELLLQPRECRTTEL
GIPKDEKLDAQVRAAVEMYTEDWIIAHRRYQHLSTAHSPITTEAQRERQKGLTRQVFEQD
APGDEKCGPEDSDDPRHSSGSPEDTPRSSGASGIFDLRNLAADSLLPSLLERVAPEDVDR
RNEALRRQHRPRTLLTLYPAPDEDEAVERCSYPDPPHEHFGQRILVKCLSLKFEIEIEPI
FGILALYDVREKKKISENFYFDLNSDSMKGLLRAHGTHPAISTLARSAIFSVTYPSPDIF
LVIKLEKVLQQGDISECCEPYMVMKEADAAKVSRWGWSWW
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcggctggaagcgtgggatcgtgggggcgtggcccgggggccttcctggaggtggtg
gtgcagggaaagctggagccgggcgtcatctgcgccccctcccaaactcttggcccttct
cgatccccgagcccgtcccatcctctgtgcccgatctctggcgtctctgggcctgttcct
gtgcccttgagtgctggcttctaccctgccctgccaccaacactgctccccaaggtgtgg
atgcggtctcccgagggccgggggccgcgggcaggtcgctcacccagctccaagacagtg
gcagctgaggtgcggaagcaagtgtcccgggaacgcagcggctctccccactccagcagg
cgctgcagcagttccctgggggtcccactgactgaagtcattgagcccctggactttgag
gatgtgatactgagccggccgccagatgctgagcccgggcccctccgagacctggttgag
tttccagtggatgacctggagctgctgctgcagccccgagaatgccggaccacggagctc
gggattcccaaggatgaaaaactggatgcccaggtgagggccgcggtggagatgtacaca
gaggactggatcattgcccacagaaggtaccagcatctgagtacggcacacagtcccatc
accacagaggcccagcgagagcggcagaagggcctcacccgccaggtctttgagcaggat
gctcctggggatgagaagtgcggcccagaggactcggatgacccccggcactcctcgggc
tccccagaggacactccacgaagcagtggcgcctctggcatctttgacctgaggaacttg
gcagccgactcgctgctgccctcattgctggagcgtgtggcccctgaggacgtggaccgg
cgtaacgaggccctgcggaggcagcaccggccccgcaccctgctcaccctctatccggcg
cctgacgaggatgaggctgtggaacgctgcagctacccggacccgccccacgaacacttt
ggacagaggatcctggtcaagtgtctgtctctcaagttcgagatcgagattgagcccatc
tttggcatcttggccctgtacgatgtgcgggagaaaaagaagatctcggagaatttctac
tttgacctgaactcagattccatgaagggattgctgcgggcccacggcactcatccagcc
atctccaccctggcccgctccgccatcttctctgtgacttatccctcacctgacatcttc
ttggtcatcaagctggagaaggtgttacagcagggggacatcagtgagtgctgtgagccc
tacatggtgatgaaggaggcggacgcagccaaggtaagcaggtggggctggtcctggtgg
tga

DBGET integrated database retrieval system