KEGG   Desmodus rotundus (common vampire bat): 112301486Help
Entry
112301486         CDS       T05907                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis protein 6 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112301486 (DOCK6)
Membrane trafficking [BR:dro04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    112301486 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 112301486
NCBI-ProteinID: XP_024412720
Position
Unknown
AA seq 1691 aa AA seqDB search
MPFAWTAVHLANIVSSAGQPERDSDSEGERRPSWTDRRRRGPPDRMSSGDDACSFSSFRP
ATLTVTNFFKQEAERLSDEDLFKFLADMRRPSSLLRRLRPVTAQLKIDISPAPENPHFCL
SPELLHVKPYPDPRGRPTKEILEFPTREVYAPHTGYRNLLYVYPHSLNFSSRQGSVRNLT
VRVQYMAGEDPSQALPVIFGKSSCSEFTREAFTPVVYHNKSPEFYEEFKLHLPACVTENH
HLLFTFYHVSCQPRPGTALETPVGFTWIPLLQHGRLRTGPFCLPVSVDQPPPSYSVLTPD
VALPGMRWVDGHKGVFNVELMAVSSVHPQDPYLDKFFTLVHVLEEGAFPFRLKDGVLSEG
TVEQELRASLAALRLTSPEFLVAFSHHVLDKLVRLVVRPPIIGGQIVNLGRGAFEAMAHV
VSLIHRSLEAAQDARGHCLLLAAYVYYAFRLPGTESSLLGGAPPVTVQPATLARGPGRPA
SLYLARSKSISSSNPDLAVAPGSVDDEVSRILASKGIDRSHSWVNSAYAPGGSKAVLRRA
PPYCGADPRQLLHEELALQWVVSGSAVREAVLQHAWFFFQLMVKSMALHLILSQRLDTPR
KLRFPGRFLDDIAALVGSVGLEVITRVHKDMELAERLNASLAFFLSDLLSLADRGFVFSL
VRSHYKQVATRLQSAPNPGALLTLRMDFTRILCSHEHYVILNLPCCPLSPPASPSPSVSS
TTSQSSTFSSQAPDPKVTSMFELSGPFRQQHFLAGLLLTELALALDPEAEGASQLHKKAI
SAVHSLLCGHDVDPRYAEATVKARVAELYLPLLSLARDTLPRLHDFAEGPGQRSRLASML
DSDTEGEGDIGGTINPSVAMAIAGGPLAPGSRASISQGPATGSRSSCPLSAESSRTLLVC
VLWVLKNAEPALLQHWAADLSLPQLGRLLDLLYLCLAAFEYKGKKAFERINSLTFKKSLD
MKARLEEAILGTIGARQEMVRRSRERSPFGNQDNVRWRKSVTHWKQTSDRVDKTKEEMEH
EALVDGNLATEASLIVLDTLEIIVQTVMLSEARESVLGAVLKVVLYSLGTAQSALFLQHG
LATQRTLVSKFPELLFEEDTELCADLCLRLLRHCGSRISTIRTHASASLYLLMRQNFEIG
HNFARVKMQVTMSLSSLVGTTQNFSEEHLRRSLKTILTYAEEDVGLRDSTFAEQVQDLMF
NLHMILTDTVKMKEHQEDPEMLIDLMYRIARGYQGSPDLRLTWLQNMAGKHAELGNHAEA
AQCMVHAAALVAEYLALLEDSRYLPVGCVSFQNISSNVLEESAISDDILSPDEEGFCSGK
HFTELGLVGLLEQAAAYFTMGGLYEAVNEVYKTLIPILEAHRDYKKLAAVHGKLQEAFTK
IMHQSSGWERVFGTYFRVGFYGTRFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERFGE
DVVEIVKDSNPVDKTKLDPQKAYIQITYVEPHFDTYELKDRVTYFDRNYGLRTFLFCTPF
TPDGRAHGELHEQHKRKTLLSTDHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTREL
AFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLAEIPEDPKLFRHHNKLRLCFKD
FCKKCEDALRKNKALIGPDQKEYHRELERNYTRLREALQPLLTQRLPQLLAPTTASFRNS
LNRASFRKADL
NT seq 5076 nt NT seq  +upstreamnt  +downstreamnt
atgccattcgcctggacagctgtgcacttagccaacatcgtgagcagcgctgggcagcct
gagcgagattccgactcagagggtgagcgccgaccttcctggactgaccgccgccgtcgg
ggacccccagaccggatgagtagcggggacgatgcctgcagcttctccagcttccgccct
gccacactaactgtcaccaacttctttaagcaggaagccgagcggctcagtgatgaggat
ctcttcaagttcctggctgacatgcggcgcccgtcatccttgctgcggcgtctacggcca
gtgactgcccagctcaagatcgacatctccccggcccccgagaacccccacttctgtctt
tccccggagctgcttcatgtcaagccctacccagaccccaggggccggcccaccaaggag
atcctggagttccccacccgtgaagtctacgctccccacacaggctacaggaacctgctc
tacgtgtacccgcatagcctcaacttcagcagccgccagggctccgtgcgcaacctcacc
gtgcgagtgcagtacatggcgggcgaggaccccagccaggccctgccggtcatctttggc
aagtccagttgcagcgaattcacccgagaagccttcacaccggtggtttaccacaacaag
tcccctgagttttacgaggagttcaagctgcatcttcccgcatgtgtgactgagaaccac
cacctgctcttcaccttctaccatgtcagctgccagccccggcctggcacagccctggag
actcctgtgggctttacttggatcccgttgctgcagcacggccgcctgaggacgggcccc
ttctgcctcccagtgtctgtggaccagcccccgcccagctactccgtgctcacacctgat
gtggcgctgccgggcatgcgctgggtggatggccacaagggcgtgttcaacgtggagctc
atggctgtgtcctccgtgcatccccaggacccatacctggataagttcttcaccctggtt
catgtcctggaggagggcgccttcccattccggctcaaggacggcgtgctgagtgagggc
accgtggagcaggagctgcgggccagcctggcagccctgcgcctcacaagccctgagttc
ctcgtcgccttctctcaccacgtgctggacaagcttgtgcgtctggtcgtgcggcctcca
atcatcggcggccagattgtgaacctgggtcgtggagcttttgaagcaatggcccatgta
gtcagcctcatccatcggagtctggaagctgcccaggatgcccgtggtcattgccttctg
ctggctgcctatgtctactatgccttccgcctgcctggcaccgagtccagcctcctgggt
ggggcccctccagtgacagtgcagcctgccacgctggcccgtggccctggccgccctgcg
agcctctacctggctcgctctaagagcattagcagcagcaatcctgatctggctgtggcc
cccggctctgtggacgacgaggtctcccgcatcttggccagcaagggtatcgaccgctca
cactcctgggtgaattctgcttatgctccaggaggcagcaaggctgtgctgcgccgggca
cccccatattgtggggccgaccccagacagctgcttcacgaggagctggctctgcagtgg
gtggtcagcggcagtgccgtgcgtgaggccgtcttgcagcacgcctggttcttcttccag
ctcatggtgaagagcatggccctgcacctgattctgagccagcggctggacacgccccgc
aagcttcgcttccctgggcgcttcttggacgacatcgcagccctggtgggctctgtgggc
ctggaggtcatcacccgggtccacaaggacatggagctggccgagcgcctcaatgccagc
ctggccttcttcctcagcgacctactgtccctggcggaccgcggctttgtgttcagcctg
gtccggtcccactataagcaggtggccactcggctgcagtcagcccccaaccccggggca
ctgctgaccctgcgcatggacttcacccgcatcctgtgcagccacgagcactatgtgatc
ctcaacctcccctgctgccccctgtcgcccccagcctcgccctcaccctcggtatcctcc
accacctcccagagttccaccttctccagccaggccccagaccccaaagtgaccagcatg
tttgagctgagcgggccattccgacagcagcacttcctggctgggctcctgctgacagaa
ctggccctggccctggaccctgaggccgagggggcatcccagctgcacaagaaggccatc
agtgctgtccacagcctgctgtgtggccatgatgttgatccccgttacgctgaggccaca
gtgaaggcccgtgtggccgagctgtacctgccactgctgtcgcttgcccgggacacgctg
ccacggctgcatgattttgcggagggcccaggtcaacggtcaaggctagcttcaatgctc
gactcagacacagaaggggaaggggacattggaggcaccatcaatccctcagtggccatg
gccatcgctggtggccccctggcccctggctcccgggccagcatctcccagggcccagcg
actggttctcgctcaagctgtcccctctctgccgagtccagccggaccctgctggtgtgt
gtgctgtgggtcctgaagaatgcagagccagccctcctgcagcactgggctgccgacctg
tccctgcctcagctgggccgtctcttggacttgctgtacctctgcctggctgccttcgag
tacaaggggaaaaaggcctttgagcgcatcaacagcctcacattcaagaagtcactagac
atgaaggctcgcctggaagaagccatcttgggcaccattggagcacgacaggagatggtg
cgacgcagccgtgaaaggagcccgtttgggaaccaggacaacgtacgctggcggaagagc
gtcacacactggaaacaaacctcggaccgtgtggacaagaccaaggaggaaatggaacac
gaggccttggtggatgggaacctagcaactgaggcgagcctgatagttctggacacactg
gagatcatcgtgcagacggtgatgctgtcagaggcccgggagagtgtcctgggtgcagta
ctgaaggtcgtgttatatagtctgggcactgcccagagtgccctcttcttgcagcatggc
ctggccacacagcggaccctggtgtccaagttccctgagctgctgttcgaggaggacacg
gagctgtgtgccgacctctgcctgaggctcctgaggcactgcggcagccgcatcagcacc
attcgcacacatgccagcgcctccctctacctcctcatgcgccagaatttcgagattggc
cataactttgcccgtgtgaagatgcaagtgaccatgtcgctgtcatccctggtgggaacg
acccagaacttcagtgaggagcacctgcgacgatctctcaagaccatcctcacctatgcc
gaggaggacgtggggctgcgggacagcacttttgcagagcaggtccaggacctgatgttc
aacctgcacatgatcctgacagacacagtgaagatgaaggagcatcaggaggaccccgag
atgctcatcgacctcatgtacaggattgcccgtggctaccaaggctccccagacttgcgg
ctgacatggctgcagaacatggctgggaagcacgcagagctgggcaaccacgcggaggct
gcgcaatgcatggtgcacgcggccgcactggtggctgagtacctcgccctgctcgaggat
agccgctacctgcccgtgggctgtgtttccttccagaacatctcgtccaatgtgctggag
gagtctgccatctccgacgacattctgtcgcccgacgaggagggcttctgctccgggaag
cacttcacggaactggggctagtgggactactggagcaggcagccgcctacttcaccatg
ggtgggctctatgaggcagtgaatgaggtatacaagaccttgatccccatcctggaagcc
caccgtgactataagaagctggcagccgtgcatggcaaactacaggaggccttcaccaag
attatgcaccagagctctggctgggagcgtgtttttggaacatacttccgtgtgggtttc
tatggtacccgctttggagacctggacgagcaggagtttgtatacaaggagccatccatc
acgaagctggctgagatctcacaccggctagaggagttctacacagagaggtttggggaa
gatgtggtcgagattgtcaaagattccaatcctgttgacaagaccaagcttgacccccag
aaggcctacatccagatcacgtatgtggagccacacttcgacacctatgagctgaaggac
cgggtgacctacttcgaccgcaactatgggctgcgcaccttcctgttctgcacgcccttc
acacccgatggccgtgctcacggggagctgcatgagcaacacaagcgcaagacactgctg
agcacagaccatgccttcccctacatcaagacacgcattcgtgtgtgccaccgggaggag
acagtgttgacaccagtggaggtggccatcgaggacatgcagaagaagacacgggagctg
gcctttgccactgagcaggacccacctgatgccaagatgctgcagatggtgctacagggc
tctgtggggcccactgtgaaccagggtcccctggaggtggcccaggtgtttttggcagag
atcccggaagatcccaagcttttcaggcatcacaacaagctacggctctgtttcaaggac
ttctgcaagaagtgtgaggacgcactgcggaagaacaaggccctgattgggccagaccag
aaagagtaccaccgtgagctagagcgcaactacacccgcctacgagaggctttgcagcct
ctcctcacccagcgcctgccccagctgctggcaccaaccacagccagcttcaggaactcc
ttgaacagagcaagtttccggaaggccgacctctga

DBGET integrated database retrieval system