KEGG   Desmodus rotundus (common vampire bat): 112301746
Entry
112301746         CDS       T05907                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04114  Oocyte meiosis
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04218  Cellular senescence
dro04261  Adrenergic signaling in cardiomyocytes
dro04270  Vascular smooth muscle contraction
dro04350  TGF-beta signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04520  Adherens junction
dro04540  Gap junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04713  Circadian entrainment
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04730  Long-term depression
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04912  GnRH signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro04929  GnRH secretion
dro04930  Type II diabetes mellitus
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro05010  Alzheimer disease
dro05020  Prion disease
dro05034  Alcoholism
dro05132  Salmonella infection
dro05133  Pertussis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112301746 (MAPK1)
   04012 ErbB signaling pathway
    112301746 (MAPK1)
   04014 Ras signaling pathway
    112301746 (MAPK1)
   04015 Rap1 signaling pathway
    112301746 (MAPK1)
   04350 TGF-beta signaling pathway
    112301746 (MAPK1)
   04370 VEGF signaling pathway
    112301746 (MAPK1)
   04371 Apelin signaling pathway
    112301746 (MAPK1)
   04668 TNF signaling pathway
    112301746 (MAPK1)
   04066 HIF-1 signaling pathway
    112301746 (MAPK1)
   04068 FoxO signaling pathway
    112301746 (MAPK1)
   04072 Phospholipase D signaling pathway
    112301746 (MAPK1)
   04071 Sphingolipid signaling pathway
    112301746 (MAPK1)
   04024 cAMP signaling pathway
    112301746 (MAPK1)
   04022 cGMP-PKG signaling pathway
    112301746 (MAPK1)
   04151 PI3K-Akt signaling pathway
    112301746 (MAPK1)
   04150 mTOR signaling pathway
    112301746 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112301746 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112301746 (MAPK1)
   04210 Apoptosis
    112301746 (MAPK1)
   04218 Cellular senescence
    112301746 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112301746 (MAPK1)
   04520 Adherens junction
    112301746 (MAPK1)
   04540 Gap junction
    112301746 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112301746 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112301746 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112301746 (MAPK1)
   04620 Toll-like receptor signaling pathway
    112301746 (MAPK1)
   04621 NOD-like receptor signaling pathway
    112301746 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    112301746 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    112301746 (MAPK1)
   04660 T cell receptor signaling pathway
    112301746 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    112301746 (MAPK1)
   04659 Th17 cell differentiation
    112301746 (MAPK1)
   04657 IL-17 signaling pathway
    112301746 (MAPK1)
   04662 B cell receptor signaling pathway
    112301746 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    112301746 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    112301746 (MAPK1)
   04062 Chemokine signaling pathway
    112301746 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112301746 (MAPK1)
   04929 GnRH secretion
    112301746 (MAPK1)
   04912 GnRH signaling pathway
    112301746 (MAPK1)
   04915 Estrogen signaling pathway
    112301746 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    112301746 (MAPK1)
   04917 Prolactin signaling pathway
    112301746 (MAPK1)
   04921 Oxytocin signaling pathway
    112301746 (MAPK1)
   04926 Relaxin signaling pathway
    112301746 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    112301746 (MAPK1)
   04919 Thyroid hormone signaling pathway
    112301746 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    112301746 (MAPK1)
   04916 Melanogenesis
    112301746 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112301746 (MAPK1)
   04270 Vascular smooth muscle contraction
    112301746 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112301746 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    112301746 (MAPK1)
   04725 Cholinergic synapse
    112301746 (MAPK1)
   04726 Serotonergic synapse
    112301746 (MAPK1)
   04720 Long-term potentiation
    112301746 (MAPK1)
   04730 Long-term depression
    112301746 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    112301746 (MAPK1)
   04722 Neurotrophin signaling pathway
    112301746 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    112301746 (MAPK1)
   04380 Osteoclast differentiation
    112301746 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112301746 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112301746 (MAPK1)
   05206 MicroRNAs in cancer
    112301746 (MAPK1)
   05205 Proteoglycans in cancer
    112301746 (MAPK1)
   05203 Viral carcinogenesis
    112301746 (MAPK1)
   05230 Central carbon metabolism in cancer
    112301746 (MAPK1)
   05231 Choline metabolism in cancer
    112301746 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112301746 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112301746 (MAPK1)
   05212 Pancreatic cancer
    112301746 (MAPK1)
   05225 Hepatocellular carcinoma
    112301746 (MAPK1)
   05226 Gastric cancer
    112301746 (MAPK1)
   05214 Glioma
    112301746 (MAPK1)
   05216 Thyroid cancer
    112301746 (MAPK1)
   05221 Acute myeloid leukemia
    112301746 (MAPK1)
   05220 Chronic myeloid leukemia
    112301746 (MAPK1)
   05218 Melanoma
    112301746 (MAPK1)
   05211 Renal cell carcinoma
    112301746 (MAPK1)
   05219 Bladder cancer
    112301746 (MAPK1)
   05215 Prostate cancer
    112301746 (MAPK1)
   05213 Endometrial cancer
    112301746 (MAPK1)
   05224 Breast cancer
    112301746 (MAPK1)
   05223 Non-small cell lung cancer
    112301746 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112301746 (MAPK1)
   05020 Prion disease
    112301746 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    112301746 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112301746 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112301746 (MAPK1)
   04934 Cushing syndrome
    112301746 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112301746 (MAPK1)
   05135 Yersinia infection
    112301746 (MAPK1)
   05133 Pertussis
    112301746 (MAPK1)
   05152 Tuberculosis
    112301746 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112301746 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    112301746 (MAPK1)
   05164 Influenza A
    112301746 (MAPK1)
   05161 Hepatitis B
    112301746 (MAPK1)
   05160 Hepatitis C
    112301746 (MAPK1)
   05163 Human cytomegalovirus infection
    112301746 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112301746 (MAPK1)
   05165 Human papillomavirus infection
    112301746 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112301746 (MAPK1)
   05140 Leishmaniasis
    112301746 (MAPK1)
   05142 Chagas disease
    112301746 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112301746 (MAPK1)
   01524 Platinum drug resistance
    112301746 (MAPK1)
   01522 Endocrine resistance
    112301746 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112301746 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dro03036]
    112301746 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112301746 (MAPK1)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112301746 (MAPK1)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112301746 (MAPK1)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112301746 (MAPK1)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112301746 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 112301746
NCBI-ProteinID: XP_024412981
Position
Unknown
AA seq 323 aa
FFSSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQ
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNR
LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 972 nt   +upstreamnt  +downstreamnt
ttttttagctctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagt
ccttttgagcaccagacctactgccagagaaccctgagggagataaaaatcttactgcgc
ttcagacacgagaacatcattggtatcaatgatatcattcgagcgccaaccattgagcaa
atgaaagatgtatatatagtacaggacctcatggaaacagatctctacaagctcttgaag
acacaacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggttg
aaatacatccattcagcaaacgtactgcaccgtgacctcaaaccttccaacctgctgctc
aataccacctgcgatctcaagatatgtgattttggcttggcccgcgttgcagatccagac
catgatcacacaggtttcctgacggagtatgtagctacccgttggtacagggctccagaa
attatgttgaattccaagggctataccaagtccattgatatttggtctgtaggctgcatt
ctggcagagatgctctccaacaggcccatcttcccggggaagcattatctcgaccagctg
aaccacattctgggtattcttggatccccatcacaggaagatctgaactgcataatcaat
ttaaaagctagaaactatttgctttctctcccacacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgactccaaagctctggatttactggacaaaatgttgacctttaac
cctcacaagaggattgaggtggaacaggcgctggcccacccatatctggagcagtattat
gacccaagtgatgagcccatcgctgaagcaccattcaagtttgacatggaattggatgac
ttgcctaaggagaagctcaaagaactcatttttgaagagactgctagattccagccagga
tacagatcttaa

KEGG   Desmodus rotundus (common vampire bat): 112304801
Entry
112304801         CDS       T05907                                 

Gene name
MAPK3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04114  Oocyte meiosis
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04218  Cellular senescence
dro04261  Adrenergic signaling in cardiomyocytes
dro04270  Vascular smooth muscle contraction
dro04350  TGF-beta signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04520  Adherens junction
dro04540  Gap junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04611  Platelet activation
dro04620  Toll-like receptor signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04668  TNF signaling pathway
dro04713  Circadian entrainment
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04730  Long-term depression
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04912  GnRH signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro04929  GnRH secretion
dro04930  Type II diabetes mellitus
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro05010  Alzheimer disease
dro05020  Prion disease
dro05034  Alcoholism
dro05132  Salmonella infection
dro05133  Pertussis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112304801 (MAPK3)
   04012 ErbB signaling pathway
    112304801 (MAPK3)
   04014 Ras signaling pathway
    112304801 (MAPK3)
   04015 Rap1 signaling pathway
    112304801 (MAPK3)
   04350 TGF-beta signaling pathway
    112304801 (MAPK3)
   04370 VEGF signaling pathway
    112304801 (MAPK3)
   04371 Apelin signaling pathway
    112304801 (MAPK3)
   04668 TNF signaling pathway
    112304801 (MAPK3)
   04066 HIF-1 signaling pathway
    112304801 (MAPK3)
   04068 FoxO signaling pathway
    112304801 (MAPK3)
   04072 Phospholipase D signaling pathway
    112304801 (MAPK3)
   04071 Sphingolipid signaling pathway
    112304801 (MAPK3)
   04024 cAMP signaling pathway
    112304801 (MAPK3)
   04022 cGMP-PKG signaling pathway
    112304801 (MAPK3)
   04151 PI3K-Akt signaling pathway
    112304801 (MAPK3)
   04150 mTOR signaling pathway
    112304801 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112304801 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112304801 (MAPK3)
   04210 Apoptosis
    112304801 (MAPK3)
   04218 Cellular senescence
    112304801 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112304801 (MAPK3)
   04520 Adherens junction
    112304801 (MAPK3)
   04540 Gap junction
    112304801 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    112304801 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112304801 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112304801 (MAPK3)
   04620 Toll-like receptor signaling pathway
    112304801 (MAPK3)
   04621 NOD-like receptor signaling pathway
    112304801 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    112304801 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    112304801 (MAPK3)
   04660 T cell receptor signaling pathway
    112304801 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    112304801 (MAPK3)
   04659 Th17 cell differentiation
    112304801 (MAPK3)
   04657 IL-17 signaling pathway
    112304801 (MAPK3)
   04662 B cell receptor signaling pathway
    112304801 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    112304801 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    112304801 (MAPK3)
   04062 Chemokine signaling pathway
    112304801 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112304801 (MAPK3)
   04929 GnRH secretion
    112304801 (MAPK3)
   04912 GnRH signaling pathway
    112304801 (MAPK3)
   04915 Estrogen signaling pathway
    112304801 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    112304801 (MAPK3)
   04917 Prolactin signaling pathway
    112304801 (MAPK3)
   04921 Oxytocin signaling pathway
    112304801 (MAPK3)
   04926 Relaxin signaling pathway
    112304801 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    112304801 (MAPK3)
   04919 Thyroid hormone signaling pathway
    112304801 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    112304801 (MAPK3)
   04916 Melanogenesis
    112304801 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112304801 (MAPK3)
   04270 Vascular smooth muscle contraction
    112304801 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112304801 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    112304801 (MAPK3)
   04725 Cholinergic synapse
    112304801 (MAPK3)
   04726 Serotonergic synapse
    112304801 (MAPK3)
   04720 Long-term potentiation
    112304801 (MAPK3)
   04730 Long-term depression
    112304801 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    112304801 (MAPK3)
   04722 Neurotrophin signaling pathway
    112304801 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    112304801 (MAPK3)
   04380 Osteoclast differentiation
    112304801 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112304801 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112304801 (MAPK3)
   05206 MicroRNAs in cancer
    112304801 (MAPK3)
   05205 Proteoglycans in cancer
    112304801 (MAPK3)
   05203 Viral carcinogenesis
    112304801 (MAPK3)
   05230 Central carbon metabolism in cancer
    112304801 (MAPK3)
   05231 Choline metabolism in cancer
    112304801 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112304801 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112304801 (MAPK3)
   05212 Pancreatic cancer
    112304801 (MAPK3)
   05225 Hepatocellular carcinoma
    112304801 (MAPK3)
   05226 Gastric cancer
    112304801 (MAPK3)
   05214 Glioma
    112304801 (MAPK3)
   05216 Thyroid cancer
    112304801 (MAPK3)
   05221 Acute myeloid leukemia
    112304801 (MAPK3)
   05220 Chronic myeloid leukemia
    112304801 (MAPK3)
   05218 Melanoma
    112304801 (MAPK3)
   05211 Renal cell carcinoma
    112304801 (MAPK3)
   05219 Bladder cancer
    112304801 (MAPK3)
   05215 Prostate cancer
    112304801 (MAPK3)
   05213 Endometrial cancer
    112304801 (MAPK3)
   05224 Breast cancer
    112304801 (MAPK3)
   05223 Non-small cell lung cancer
    112304801 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112304801 (MAPK3)
   05020 Prion disease
    112304801 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    112304801 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112304801 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112304801 (MAPK3)
   04934 Cushing syndrome
    112304801 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112304801 (MAPK3)
   05135 Yersinia infection
    112304801 (MAPK3)
   05133 Pertussis
    112304801 (MAPK3)
   05152 Tuberculosis
    112304801 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112304801 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    112304801 (MAPK3)
   05164 Influenza A
    112304801 (MAPK3)
   05161 Hepatitis B
    112304801 (MAPK3)
   05160 Hepatitis C
    112304801 (MAPK3)
   05163 Human cytomegalovirus infection
    112304801 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112304801 (MAPK3)
   05165 Human papillomavirus infection
    112304801 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112304801 (MAPK3)
   05140 Leishmaniasis
    112304801 (MAPK3)
   05142 Chagas disease
    112304801 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112304801 (MAPK3)
   01524 Platinum drug resistance
    112304801 (MAPK3)
   01522 Endocrine resistance
    112304801 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112304801 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dro03036]
    112304801 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112304801 (MAPK3)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112304801 (MAPK3)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112304801 (MAPK3)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112304801 (MAPK3)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112304801 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 112304801
NCBI-ProteinID: XP_024416233
Position
Unknown
AA seq 325 aa
MVSSAYDHICKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEA
MRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWSK
LFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDD
LPKERLKELIFQETARFQPGVLEAT
NT seq 978 nt   +upstreamnt  +downstreamnt
atggtcagctcagcctacgaccacatatgcaagacacgcgtggccatcaagaaaatcagc
cccttcgagcatcagacctactgccagcgcactctgcgggaaatccagatcttgctgcgt
ttccgccatgagaatgtcatcggcatccgagacattcttcgggcacctaccctggaagcc
atgagggatgtctacattgtgcaggacctgatggagacagacctgtacaagttgctcaaa
agccagcagctgagcaacgaccacgtctgctacttcctctaccagatcctgcggggcctc
aagtatatccactcagccaacgtgctgcaccgggatttaaagccctccaacctgctcatc
aataccacctgcgaccttaagatctgtgattttggcctggcccggatcgctgatcctgag
catgaccacaccggcttcctgacagaatacgtggccacacgctggtaccgggctccagag
atcatgcttaactccaagggctacaccaagtccatcgacatctggtctgtgggctgcatt
ctggctgagatgctctccaaccggcccatcttccccgggaagcactacctggaccagctc
aaccacattctaggtatcctgggctccccatcccaggaggacctgaattgtatcatcaac
atgaaggcccgaaactacctacagtccctgccttccaagaccaaggtggcctggtccaag
ctttttcccaaatcagactccaaagcccttgacctgctggaccggatgttgacctttaac
cccaataaacggatcacagtggaagaagccttggctcatccctacctggagcagtactac
gacccaacagatgagccggtggccgaggaacctttcacctttgacatggagctggacgat
ctacccaaggagcggctgaaggagctcatattccaggaaacagcccgcttccagcctggg
gtgctggaggccacctaa

DBGET integrated database retrieval system