KEGG   Desmodus rotundus (common vampire bat): 112302067
Entry
112302067         CDS       T05907                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor isoform X1
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01523  Antifolate resistance
dro04010  MAPK signaling pathway
dro04060  Cytokine-cytokine receptor interaction
dro04061  Viral protein interaction with cytokine and cytokine receptor
dro04064  NF-kappa B signaling pathway
dro04071  Sphingolipid signaling pathway
dro04150  mTOR signaling pathway
dro04210  Apoptosis
dro04217  Necroptosis
dro04350  TGF-beta signaling pathway
dro04380  Osteoclast differentiation
dro04612  Antigen processing and presentation
dro04620  Toll-like receptor signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04622  RIG-I-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04640  Hematopoietic cell lineage
dro04650  Natural killer cell mediated cytotoxicity
dro04657  IL-17 signaling pathway
dro04660  T cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04668  TNF signaling pathway
dro04920  Adipocytokine signaling pathway
dro04930  Type II diabetes mellitus
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04940  Type I diabetes mellitus
dro05010  Alzheimer disease
dro05014  Amyotrophic lateral sclerosis
dro05132  Salmonella infection
dro05133  Pertussis
dro05134  Legionellosis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05143  African trypanosomiasis
dro05144  Malaria
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05205  Proteoglycans in cancer
dro05310  Asthma
dro05321  Inflammatory bowel disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05410  Hypertrophic cardiomyopathy
dro05414  Dilated cardiomyopathy
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112302067 (TNF)
   04350 TGF-beta signaling pathway
    112302067 (TNF)
   04064 NF-kappa B signaling pathway
    112302067 (TNF)
   04668 TNF signaling pathway
    112302067 (TNF)
   04071 Sphingolipid signaling pathway
    112302067 (TNF)
   04150 mTOR signaling pathway
    112302067 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112302067 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    112302067 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112302067 (TNF)
   04217 Necroptosis
    112302067 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112302067 (TNF)
   04620 Toll-like receptor signaling pathway
    112302067 (TNF)
   04621 NOD-like receptor signaling pathway
    112302067 (TNF)
   04622 RIG-I-like receptor signaling pathway
    112302067 (TNF)
   04625 C-type lectin receptor signaling pathway
    112302067 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    112302067 (TNF)
   04612 Antigen processing and presentation
    112302067 (TNF)
   04660 T cell receptor signaling pathway
    112302067 (TNF)
   04657 IL-17 signaling pathway
    112302067 (TNF)
   04664 Fc epsilon RI signaling pathway
    112302067 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112302067 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112302067 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112302067 (TNF)
  09163 Immune disease
   05310 Asthma
    112302067 (TNF)
   05322 Systemic lupus erythematosus
    112302067 (TNF)
   05323 Rheumatoid arthritis
    112302067 (TNF)
   05321 Inflammatory bowel disease
    112302067 (TNF)
   05330 Allograft rejection
    112302067 (TNF)
   05332 Graft-versus-host disease
    112302067 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112302067 (TNF)
   05014 Amyotrophic lateral sclerosis
    112302067 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112302067 (TNF)
   05410 Hypertrophic cardiomyopathy
    112302067 (TNF)
   05414 Dilated cardiomyopathy
    112302067 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112302067 (TNF)
   04940 Type I diabetes mellitus
    112302067 (TNF)
   04932 Non-alcoholic fatty liver disease
    112302067 (TNF)
   04931 Insulin resistance
    112302067 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112302067 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112302067 (TNF)
   05135 Yersinia infection
    112302067 (TNF)
   05133 Pertussis
    112302067 (TNF)
   05134 Legionellosis
    112302067 (TNF)
   05152 Tuberculosis
    112302067 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302067 (TNF)
   05170 Human immunodeficiency virus 1 infection
    112302067 (TNF)
   05164 Influenza A
    112302067 (TNF)
   05161 Hepatitis B
    112302067 (TNF)
   05160 Hepatitis C
    112302067 (TNF)
   05168 Herpes simplex virus 1 infection
    112302067 (TNF)
   05163 Human cytomegalovirus infection
    112302067 (TNF)
   05169 Epstein-Barr virus infection
    112302067 (TNF)
   05165 Human papillomavirus infection
    112302067 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112302067 (TNF)
   05144 Malaria
    112302067 (TNF)
   05145 Toxoplasmosis
    112302067 (TNF)
   05140 Leishmaniasis
    112302067 (TNF)
   05142 Chagas disease
    112302067 (TNF)
   05143 African trypanosomiasis
    112302067 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    112302067 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112302067 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112302067 (TNF)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Tumor necrosis fators
   112302067 (TNF)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Haparin
  Cytokines
   112302067 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 112302067
NCBI-ProteinID: XP_024413369
Position
Unknown
AA seq 230 aa
MSTESMIRDVELAETVLPKKAGGLQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EEQFLIGPSLAQTLGLSSRTPSDKPVAHVVANQQTVGKLQWKSQVANALLANGVRLTDNQ
LVVPSDGLYLIYSQVLFKGQGCPPTHLLLTHTISRFAVSYPRKVSLLSAIKSPCQRETPE
GTEAKPWYEPIYLGGVFQLEKGDQLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 693 nt   +upstreamnt  +downstreamnt
atgagcactgagagcatgatccgggacgtggagctggctgagacggtgctccccaagaag
gcagggggtctccagggctccagacggtgcttgtgcctcagcctcttctccttcctcctt
gtggcaggagccaccacactcttctgcctgttgcacttcggggtgatcggcccccagagg
gaagagcagttcctaattggcccctcactggcccagacccttggattatcttctcgaacc
ccaagtgacaagcctgttgcccatgttgtagcaaaccagcaaactgtggggaagctgcag
tggaagagccaggttgccaacgctctcctggccaatggcgtgcgactgacagacaaccag
ttggttgtgccctcggacgggctgtacctcatctactcccaggtcctcttcaagggccaa
ggctgccctccaacccacttgctcctcacccacaccatcagccgctttgctgtctcttac
ccccgaaaggtcagcctcctctctgccatcaagagcccttgccagagggagaccccagag
gggactgaggccaagccctggtatgaacccatctacctgggaggggtcttccagctggag
aaaggggatcaactcagcgccgagatcaacctgcccgactatctcgattttgccgaatcc
gggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system