KEGG   Desmodus rotundus (common vampire bat): 112302142Help
Entry
112302142         CDS       T05907                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro03040  Spliceosome
dro04010  MAPK signaling pathway
dro04141  Protein processing in endoplasmic reticulum
dro04144  Endocytosis
dro04213  Longevity regulating pathway - multiple species
dro04612  Antigen processing and presentation
dro04915  Estrogen signaling pathway
dro05134  Legionellosis
dro05145  Toxoplasmosis
dro05162  Measles
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112302142
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112302142
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112302142
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112302142
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    112302142
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112302142
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    112302142
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    112302142
  09172 Infectious disease: viral
   05162 Measles
    112302142
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112302142
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112302142
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dro03041]
    112302142
   03009 Ribosome biogenesis [BR:dro03009]
    112302142
   03110 Chaperones and folding catalysts [BR:dro03110]
    112302142
   04131 Membrane trafficking [BR:dro04131]
    112302142
   03051 Proteasome [BR:dro03051]
    112302142
   03029 Mitochondrial biogenesis [BR:dro03029]
    112302142
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302142
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112302142
Spliceosome [BR:dro03041]
 Complex B
  Other components
   Prp19 complex
    112302142
 Complex C
   Prp19-CDC5 complex
    112302142
Ribosome biogenesis [BR:dro03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112302142
Chaperones and folding catalysts [BR:dro03110]
 Heat shock proteins
  HSP70 / DNAK
   112302142
Membrane trafficking [BR:dro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112302142
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112302142
Proteasome [BR:dro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112302142
Mitochondrial biogenesis [BR:dro03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112302142
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112302142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR
Motif
Other DBs
NCBI-GeneID: 112302142
NCBI-ProteinID: XP_024413493
Position
Unknown
AA seq 641 aa AA seqDB search
MAKTTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVISDGDKPKVQVSYKGETKAFYPEEVS
SMVLTKMKEIAEAYLGYPVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEAQRDRVSAKN
ALESYAFNMKSAVEDEGLQGKISEADKKKVLDKCQEVISWLDANSLAEKEEFEHKRKELE
QGCSPIISGLYQGAGGPGAGGFGAQVPKAGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaccacggccatcggcatcgacctgggcaccacctactcgtgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcaccgacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacacggtgtttgacgccaagcggctgatcggccggaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcagcgacggggacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcgttctaccccgaggaggtctcg
tccatggtcctgacgaagatgaaggagatcgccgaggcgtacctgggctacccggtgagc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccactaaggac
gcgggggtgatcgcgggtctgaacgtgctgcggatcatcaacgagcccaccgccgcggcc
atcgcctacggcctggacaggacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgaccatcgacgacggcatcttcgaggtgaag
gccacggccggcgacacccacctgggaggggaggacttcgacaacaggctggtgagccac
ttcgtggaggagttcaagcggaagcacaagaaggacatcagccagaacaagcgggccgtg
aggcggctgcgcacggcctgcgagagggccaagaggaccctgtcgtccagcacgcaggcc
agcctggagatcgactccctgttcgagggcatcgacttctacacgtccatcaccagggcg
cggttcgaggagctgtgctccgacctgttccgcagcacgctggagcccgtggagaaggcc
ttgcgcgacgccaaactggacaaggcccagatccacgacctggtgctggtgggcggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctcaac
aagagcatcaaccccgacgaggcggtggcctacggggcggcggtgcaggcagccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctccgctgtcg
ctgggcctggagacggccgggggcgtgatgactgcactgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactcggacaaccagccgggggtgctgatc
caggtgtacgagggcgagagggccatgacgcgcgacaacaacctgctggggcgcttcgag
ctgagcggcatccccccggccccccgcggcgtgccccagatcgaggtgaccttcgacatc
gacgccaatggcatcctgaacgtcacggccaccgacaagagcactggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggctgagaggtacaaagccgaggacgaggcccagcgcgacagggtgtctgccaagaac
gcgctggagtcctatgccttcaacatgaagagcgctgtggaggatgaggggctccaaggc
aagatcagcgaggcggacaagaagaaggtgctggacaagtgccaggaggtgatttcctgg
ctggatgccaacagcctggcggagaaggaggagtttgagcacaagaggaaggagctggag
caggggtgtagccccatcatcagcggactgtaccagggggcgggtggccccggggctggt
ggctttggggctcaggtcccgaaggcgggctctggctctggccccaccattgaggaggtg
gattag

DBGET integrated database retrieval system