KEGG   Desmodus rotundus (common vampire bat): 112302160
Entry
112302160         CDS       T05907                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain-like
  KO
K06752  MHC class II antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04145  Phagosome
dro04514  Cell adhesion molecules
dro04612  Antigen processing and presentation
dro04640  Hematopoietic cell lineage
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04672  Intestinal immune network for IgA production
dro04940  Type I diabetes mellitus
dro05140  Leishmaniasis
dro05145  Toxoplasmosis
dro05150  Staphylococcus aureus infection
dro05152  Tuberculosis
dro05164  Influenza A
dro05166  Human T-cell leukemia virus 1 infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05321  Inflammatory bowel disease
dro05322  Systemic lupus erythematosus
dro05323  Rheumatoid arthritis
dro05330  Allograft rejection
dro05332  Graft-versus-host disease
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112302160
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112302160
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112302160
   04612 Antigen processing and presentation
    112302160
   04658 Th1 and Th2 cell differentiation
    112302160
   04659 Th17 cell differentiation
    112302160
   04672 Intestinal immune network for IgA production
    112302160
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    112302160
   05322 Systemic lupus erythematosus
    112302160
   05323 Rheumatoid arthritis
    112302160
   05320 Autoimmune thyroid disease
    112302160
   05321 Inflammatory bowel disease
    112302160
   05330 Allograft rejection
    112302160
   05332 Graft-versus-host disease
    112302160
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112302160
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112302160
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    112302160
   05152 Tuberculosis
    112302160
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302160
   05164 Influenza A
    112302160
   05168 Herpes simplex virus 1 infection
    112302160
   05169 Epstein-Barr virus infection
    112302160
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112302160
   05140 Leishmaniasis
    112302160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112302160
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112302160
  Exosomal proteins of epithelial cells
   112302160
  Exosomal proteins of breast milk
   112302160
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 Ig_2 SKG6 I-set
Other DBs
NCBI-GeneID: 112302160
NCBI-ProteinID: XP_024413522
Position
Unknown
AA seq 255 aa
MILNRALIWGTLALITMMSLCGGEDIVADHVAAYGTSVYQSYGPSGQYTFEFDGDEEFYV
DLQKKETIWRLPEFSKFGGFDPQGGLREVATSKHNLEVLIKCSNSTAAVNEVPEVTVFPK
SRVELGQPNTLICAVDNIFPPVVNITWLSNGHPVTQGVSETSFLSKNDHSFLKISYLTFL
PSADDIYDCRVEHWGLDGPLLKHWEPEIPTPMSELTETVVCAVGLAVGLVGIVVGTVFII
QGLRPGGASRHPGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacagagctctgatttgggggaccctcgccctgatcaccatgatgagtctc
tgtggaggtgaagacattgtggctgaccacgttgctgcctatggcacaagcgtctaccag
tcctacggcccctctggccagtacacgtttgaatttgacggagacgaggagttctacgtg
gacctgcagaagaaggagacaatctggcggctgcctgagttcagcaaattcggaggtttt
gacccacagggtggactgagagaagtggctacatcaaaacacaatttggaagtcttaatt
aaatgctccaactctactgcggctgtcaatgaggttcctgaagtgactgtgtttcctaag
tctcgagtggagctgggtcagcctaacaccctcatctgtgccgtggacaatatcttccct
cctgtggtcaacatcacgtggctaagcaatgggcacccagtcacacagggtgtttccgaa
accagcttcctgtccaagaatgatcattccttcctcaagatcagctacctcaccttcctg
ccttctgccgacgacatttacgactgcagggtggagcactggggcctggacgggccactt
ctgaaacactgggagcctgagattcctactcccatgtcagagctgacagagactgtggtc
tgcgccgtggggctggccgtgggcctcgtgggcatcgtggtgggcaccgtcttcattatc
cagggcctgcgcccaggtggtgcctccagacacccagggcccttgtga

DBGET integrated database retrieval system