KEGG   Desmodus rotundus (common vampire bat): 112303301Help
Entry
112303301         CDS       T05907                                 

Gene name
MRVI1
Definition
(RefSeq) protein MRVI1 isoform X1
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    112303301 (MRVI1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112303301 (MRVI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRVI1
Motif
Other DBs
NCBI-GeneID: 112303301
NCBI-ProteinID: XP_024414609
Position
Unknown
AA seq 903 aa AA seqDB search
MGVDLTCPFGISSACRAQASWSVFGADTAEVPGTCGHSCQKAAMPHIPEDEEPPGEPQAA
QSPNGQSPPGTGVPCSPPTIVLTGDASSPEGETDKNLANRAHSPHQRLSRRHLKVSTASL
TSVDPAGHVIDLVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRRSRSIPGDSP
SAASPNLSPRASPTSLRSNSLMVPTLPGVDACSGLQSPLPGAPTQQKGDEAEVSPPHLGE
PNIPKGLADRKQNDQRKVSQGRLTPRSPTVEKSKEIAIEQKENFDPLQCLEAPPKGLASG
TGSGGKMALNSPQPGPAESDLDKPLLKTAREGNPLPRGPAQGSGGAVPSDPQGKGTAGEP
VGSKVASKVDPRPPPSRPPLHRGISRDSAPEEPGPRLQKVLAKLPLAEEEKRFAGKASSK
LAKAPGLKDFQIQVQPVRMQKLTKLREEHILMRNQNLVGLKLPDLSEAAEQEKGLPSELS
PAIEEEESKSGLDVMPNISDMLLRKLRVHKSLPGSAPPLTEKEVENVFVQLSLAFRNDSY
TLESRINQAERERNLTEENTEKELENFKASITSSASLWQHCEHRETYQKLLEDIAVLHRL
AARLSSRAEMVGAIRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEFKKLANQNSSRSC
GPSEDGVPRTARSMSLNLGKNMPRRRVSVAVVPKFNALNLPSQPASSLPIPSLPALSESP
NGKGNLPVVTSALPALLENGKTNGDPACDASVPMPTPSCLQEISQETKAGMEEEGFNKRY
QEGLKKTKELQELEEEEERKSESPEEAEEAEDIEEEGKDQRSSKLEELVHFLQVMYPKLC
QHWQVIWMMAAAMLVLTVVLGLYNSYNSCVEQADGPLGRSTCSASQRDSWWNSGLQHEQP
TEQ
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgggagtggatttgacttgtccttttggcatctcctcagcctgcagagcccaggcctct
tggagcgtctttggggctgacacagcagaggttccgggcacctgcggccactcctgtcag
aaggctgccatgccccacattcctgaggatgaggagccccctggagagccacaggcagcc
cagagccccaacggccaaagccctccaggcacgggagtaccttgcagcccacccaccatt
gtcctgactggggatgccagttcaccggaaggagaaactgacaaaaacctggccaacaga
gctcacagtccccaccagaggctttctcgccgacacttgaaggtttccacggcttcactg
acttctgtggaccctgcagggcatgtcattgacctggtaaatgaccagctgccagacatc
agcatctcagaggaggacaagaagaaaaacctggctctgctggaggaagccaagctggtg
agtgagcgattcctgactcgccgtgggaggaggtccaggagcatccccggagactcccca
tcagctgcttccccaaacctcagccccagagcttctcctacatccttgaggagcaactca
ctcatggtccccacactgcctggtgtggatgcatgcagtggcctgcagtcccctctgcct
ggagcaccaacacagcagaagggggatgaggccgaagtctctccacctcaccttggcgag
cctaatatccccaaagggctagctgaccggaagcaaaatgaccagaggaaagtgtctcag
ggcaggctgactcctcgctctcccacagttgagaagtccaaagagattgcaatagaacaa
aaggaaaactttgatcccctccagtgcctggaggccccacccaaaggcctagcttctggc
acaggcagtggtgggaaaatggctctgaacagcccccagcctggccctgctgagagcgat
ctggacaagccactcttgaagacagccagggagggcaaccctctgccccgaggtccagcc
cagggctctggaggggcggttccctcagacccccagggcaaaggcacagctggagaacca
gtagggtccaaggttgcctccaaagtggatcctcggccccctccttcccggccacccttg
catcgggggatctcccgggacagtgcccctgaagaacctggcccccggctgcagaaagtg
cttgccaagctgcccctggcagaggaagagaagcgttttgcggggaaagccagcagcaag
ttggccaaggcgcctggactcaaagactttcagatacaagtgcagcctgtgcggatgcag
aaactgaccaagctccgagaggagcacatcctgatgagaaatcagaacttagtggggctc
aagcttccagaccttagtgaagcggctgagcaggaaaaagggctcccttctgaactgtcc
ccagctattgaggaagaagagtcaaagagtggcttggatgtcatgcccaatatttctgac
atgctgctgcgcaaactgcgggtccacaaatctcttcctgggagtgcccctccactcact
gaaaaggaagttgagaacgtgtttgtacaactgtccttggcctttagaaatgacagctat
accctggaatctagaattaaccaggctgaaagggaacgcaacctgacggaagagaacact
gagaaggaactggaaaacttcaaagcttccattacgtcttcagcttctctctggcagcac
tgtgagcaccgggagacctaccagaagctgctggaggacatcgctgtcctgcaccgcctg
gccgcccgcctctccagccgggctgagatggtgggggccatccgccaggaaaagcgcatg
tcaaaggcaacagaggtgatgatgcagtatgtggagaacctgaagaggacatatgagaag
gaccatgcagagctcatggaatttaaaaaactggcaaatcagaattcaagccgcagctgc
ggcccctctgaagacggggtccctcgcacagcgcggtccatgtccctcaatctgggaaag
aacatgccccgccggagggtcagcgttgccgtggttcccaagtttaatgccctgaacctg
cccagtcagcctgcaagctcgttacccatcccctccttaccggccctgtcggaatcacct
aatgggaaaggcaatctacctgtcgtcacctcagcactgcctgcacttctagaaaatgga
aaaacaaatggggacccagcttgtgatgcctcggttcccatgccaactccaagctgcctg
caggagattagccaggagaccaaggccgggatggaagaagaagggttcaacaagagatac
caggaaggtctaaagaagaccaaagagcttcaagaactagaggaggaggaagaacggaag
agcgagagtcctgaggaagccgaagaggcagaagacattgaggaggagggaaaggaccag
agaagcagcaaacttgaagagttggttcatttcttacaagtcatgtatcccaaactgtgt
cagcactggcaagtcatctggatgatggctgcggcgatgctggtcttgactgttgtgttg
gggctgtacaattcctataactcttgtgtggagcaggccgatgggccccttggaagatcc
acctgctcagcatcccagagggactcctggtggaactcaggactccagcatgagcagcct
acagagcagtag

DBGET integrated database retrieval system