KEGG   Desmodus rotundus (common vampire bat): 112303396
Entry
112303396         CDS       T05907                                 

Gene name
ARNTL
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 1 isoform X1
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04710  Circadian rhythm
dro04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    112303396 (ARNTL)
  09159 Environmental adaptation
   04710 Circadian rhythm
    112303396 (ARNTL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112303396 (ARNTL)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112303396 (ARNTL)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 112303396
NCBI-ProteinID: XP_024414746
Position
Unknown
AA seq 633 aa
MADQRMDISSTISDFMSPGASDLLSSPLGTGGVDCTRKRKGSSTDYQLDDFSFEESMDTD
KDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLT
VLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVS
ESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDIT
PGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPP
TKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFV
DQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSF
ITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPSFPQLTASPHSMDSMLPSGEGG
PKRAQPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDAS
SPGGKKILNGGTPDIPSIGLLPGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSP
SNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggcggaccagagaatggacatctcttcaacaatcagtgatttcatgtctccaggcgcc
agcgacctcctctccagcccccttggcaccggtggcgtggattgcacccgcaaacggaaa
ggcagctccactgactaccaacttgatgacttttcttttgaggaaagcatggacacagac
aaagatgaccctcatggaaggttagaatacacagagcaccaagggaggatcaaaaatgca
agggaagctcacagtcaaattgaaaaaaggcgtcgggataaaatgaacagttttattgat
gaattggcttccttggtaccaacatgcaacgcaatgtcccggaaactagataaacttact
gtgctccggatggctgttcagcacatgaaaacactacgaggtgccaccaatccctacaca
gaagcaaactacaaaccaacctttctgtcagatgatgaattgaaacacctcattctcagg
gcagcagatggatttttgtttgtcgtaggatgtgaccgagggaagatactctttgtctca
gagtctgtcttcaagatcctcaactacagccagaatgatctgattggtcagagcttgttt
gactacctacatcctaaagacattgccaaagtcaaggagcagctctcctcctccgacaca
gcaccccgggagcgactcatagatgcaaaaactggacttccagttaagacagatataacc
cctgggccatctcggttatgttctggagcacgacgttctttcttctgtaggatgaagtgt
aacaggccttcagtaaaggttgaagacaaggatttcccctccacctgctcaaagaaaaaa
gcagatcgaaaaagcttctgcacaatccacagcacaggctatttgaaaagctggccaccc
acaaagatggggctggatgaagacaatgaaccagacaatgaggggtgtaatctcagctgc
ctcgttgcaataggacggctgcattctcacgtggttccacagccggtgaacggggagatc
agggtgaaatctatggaatatgtttctcggcacgccatagatgggaagttcgtctttgta
gaccagagggcaacagctattttggcatatttaccacaagaacttctaggcacatcatgt
tatgaatattttcaccaagatgacataggacaccttgcagaatgtcataggcaagtttta
cagacgagagaaaagattacaactaactgctataagtttaaaatcaaagatggttctttc
atcacactgcggagtcgatggttcagtttcatgaacccttggaccaaggaagtagaatac
attgtctcaaccaacaccgttgttttagccaacgtcctggaaggcggggacccaagcttc
ccgcagctcacagcgtccccccacagcatggacagcatgctgccctctggagaaggtggt
cctaagagggcccagcccactgttccagggattccagggggaaccagggctggggcagga
aaaataggtcgaatgattgctgaggaaatcatggaaatccacaggataagggggtcatcg
ccttccagctgtggctccagcccgctgaacatcacaagcacaccgccccctgatgcctct
tctccaggaggcaagaagattttgaatggagggactccagacattccttccattggcctg
ctaccggggcaggctcaggagaacccaggttatccatactctgacagttcttctattctt
ggtgagaacccgcacataggcatagacatgatagacaacgatcaaggctcaagcagtccc
agtaatgacgaagcagcgatggccgtcataatgagcctcttggaagcagatgctgggttg
ggtggccctgttgactttagcgacttgccatggccgctgtaa

DBGET integrated database retrieval system