KEGG   Desmodus rotundus (common vampire bat): 112304041
Entry
112304041         CDS       T05907                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04062  Chemokine signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04137  Mitophagy - animal
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04540  Gap junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04714  Thermogenesis
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04730  Long-term depression
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04912  GnRH signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro05010  Alzheimer disease
dro05034  Alcoholism
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112304041
   04012 ErbB signaling pathway
    112304041
   04014 Ras signaling pathway
    112304041
   04015 Rap1 signaling pathway
    112304041
   04370 VEGF signaling pathway
    112304041
   04371 Apelin signaling pathway
    112304041
   04068 FoxO signaling pathway
    112304041
   04072 Phospholipase D signaling pathway
    112304041
   04071 Sphingolipid signaling pathway
    112304041
   04151 PI3K-Akt signaling pathway
    112304041
   04150 mTOR signaling pathway
    112304041
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112304041
   04137 Mitophagy - animal
    112304041
  09143 Cell growth and death
   04210 Apoptosis
    112304041
   04218 Cellular senescence
    112304041
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112304041
   04550 Signaling pathways regulating pluripotency of stem cells
    112304041
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112304041
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112304041
   04650 Natural killer cell mediated cytotoxicity
    112304041
   04660 T cell receptor signaling pathway
    112304041
   04662 B cell receptor signaling pathway
    112304041
   04664 Fc epsilon RI signaling pathway
    112304041
   04062 Chemokine signaling pathway
    112304041
  09152 Endocrine system
   04910 Insulin signaling pathway
    112304041
   04929 GnRH secretion
    112304041
   04912 GnRH signaling pathway
    112304041
   04915 Estrogen signaling pathway
    112304041
   04914 Progesterone-mediated oocyte maturation
    112304041
   04917 Prolactin signaling pathway
    112304041
   04921 Oxytocin signaling pathway
    112304041
   04926 Relaxin signaling pathway
    112304041
   04935 Growth hormone synthesis, secretion and action
    112304041
   04919 Thyroid hormone signaling pathway
    112304041
   04916 Melanogenesis
    112304041
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112304041
  09156 Nervous system
   04725 Cholinergic synapse
    112304041
   04726 Serotonergic synapse
    112304041
   04720 Long-term potentiation
    112304041
   04730 Long-term depression
    112304041
   04722 Neurotrophin signaling pathway
    112304041
  09158 Development and regeneration
   04360 Axon guidance
    112304041
  09149 Aging
   04211 Longevity regulating pathway
    112304041
   04213 Longevity regulating pathway - multiple species
    112304041
  09159 Environmental adaptation
   04714 Thermogenesis
    112304041
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112304041
   05206 MicroRNAs in cancer
    112304041
   05205 Proteoglycans in cancer
    112304041
   05203 Viral carcinogenesis
    112304041
   05230 Central carbon metabolism in cancer
    112304041
   05231 Choline metabolism in cancer
    112304041
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112304041
  09162 Cancer: specific types
   05210 Colorectal cancer
    112304041
   05212 Pancreatic cancer
    112304041
   05225 Hepatocellular carcinoma
    112304041
   05226 Gastric cancer
    112304041
   05214 Glioma
    112304041
   05216 Thyroid cancer
    112304041
   05221 Acute myeloid leukemia
    112304041
   05220 Chronic myeloid leukemia
    112304041
   05218 Melanoma
    112304041
   05211 Renal cell carcinoma
    112304041
   05219 Bladder cancer
    112304041
   05215 Prostate cancer
    112304041
   05213 Endometrial cancer
    112304041
   05224 Breast cancer
    112304041
   05223 Non-small cell lung cancer
    112304041
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112304041
  09165 Substance dependence
   05034 Alcoholism
    112304041
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112304041
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112304041
   05170 Human immunodeficiency virus 1 infection
    112304041
   05161 Hepatitis B
    112304041
   05160 Hepatitis C
    112304041
   05163 Human cytomegalovirus infection
    112304041
   05167 Kaposi sarcoma-associated herpesvirus infection
    112304041
   05165 Human papillomavirus infection
    112304041
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112304041
   01522 Endocrine resistance
    112304041
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112304041
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dro04031]
    112304041
Membrane trafficking [BR:dro04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112304041
GTP-binding proteins [BR:dro04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112304041
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase G-alpha Septin DUF2075
Other DBs
NCBI-GeneID: 112304041
NCBI-ProteinID: XP_024415403
Position
Unknown
AA seq 161 aa
MGEYKLVVAGASGIGKTALRIQIIQNHFVDEHDRTIKDSHRKQIVIDGETCFLDTLDTAG
QEYSAMRDQYMMTGEGFLCVFALNNTKSFEDIRYYGEVKRVKDLEDVPVVLVGNKCDLPS
KAVDTKQVQDLARSYRISFIETSVKTRPGIDNAFYKLVQEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atgggtgaatataaacttgtagtagctggtgctagtggtataggcaagactgccttgagg
atacagataattcagaatcactttgtggatgaacatgatcgtacaataaaggattcccac
aggaaacaaatagtaattgatggagaaacctgtttcttggatactctagacacagcaggt
caagagtacagtgcaatgagggaccagtacatgatgactggagagggctttttgtgtgta
tttgccttaaataatactaaatcatttgaagatattcgctattatggagaagtgaaaaga
gttaaagacttggaagatgtacctgtggtcctagtaggaaataaatgtgatttgccttct
aaagcagtagacacaaaacaggtacaggacttagcaagaagttacagaatttcttttatt
gaaacatcagtaaagacaagaccgggtattgacaatgccttctataaattagttcaggaa
atctga

KEGG   Desmodus rotundus (common vampire bat): 112313707
Entry
112313707         CDS       T05907                                 

Gene name
NRAS
Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04062  Chemokine signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04137  Mitophagy - animal
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04540  Gap junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04714  Thermogenesis
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04730  Long-term depression
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro05010  Alzheimer disease
dro05034  Alcoholism
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112313707 (NRAS)
   04012 ErbB signaling pathway
    112313707 (NRAS)
   04014 Ras signaling pathway
    112313707 (NRAS)
   04015 Rap1 signaling pathway
    112313707 (NRAS)
   04370 VEGF signaling pathway
    112313707 (NRAS)
   04371 Apelin signaling pathway
    112313707 (NRAS)
   04068 FoxO signaling pathway
    112313707 (NRAS)
   04072 Phospholipase D signaling pathway
    112313707 (NRAS)
   04071 Sphingolipid signaling pathway
    112313707 (NRAS)
   04151 PI3K-Akt signaling pathway
    112313707 (NRAS)
   04150 mTOR signaling pathway
    112313707 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112313707 (NRAS)
   04137 Mitophagy - animal
    112313707 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    112313707 (NRAS)
   04218 Cellular senescence
    112313707 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112313707 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    112313707 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112313707 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112313707 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    112313707 (NRAS)
   04660 T cell receptor signaling pathway
    112313707 (NRAS)
   04662 B cell receptor signaling pathway
    112313707 (NRAS)
   04664 Fc epsilon RI signaling pathway
    112313707 (NRAS)
   04062 Chemokine signaling pathway
    112313707 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112313707 (NRAS)
   04929 GnRH secretion
    112313707 (NRAS)
   04912 GnRH signaling pathway
    112313707 (NRAS)
   04915 Estrogen signaling pathway
    112313707 (NRAS)
   04917 Prolactin signaling pathway
    112313707 (NRAS)
   04921 Oxytocin signaling pathway
    112313707 (NRAS)
   04926 Relaxin signaling pathway
    112313707 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    112313707 (NRAS)
   04919 Thyroid hormone signaling pathway
    112313707 (NRAS)
   04916 Melanogenesis
    112313707 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    112313707 (NRAS)
   04726 Serotonergic synapse
    112313707 (NRAS)
   04720 Long-term potentiation
    112313707 (NRAS)
   04730 Long-term depression
    112313707 (NRAS)
   04722 Neurotrophin signaling pathway
    112313707 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    112313707 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    112313707 (NRAS)
   04213 Longevity regulating pathway - multiple species
    112313707 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    112313707 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112313707 (NRAS)
   05206 MicroRNAs in cancer
    112313707 (NRAS)
   05205 Proteoglycans in cancer
    112313707 (NRAS)
   05203 Viral carcinogenesis
    112313707 (NRAS)
   05230 Central carbon metabolism in cancer
    112313707 (NRAS)
   05231 Choline metabolism in cancer
    112313707 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112313707 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112313707 (NRAS)
   05225 Hepatocellular carcinoma
    112313707 (NRAS)
   05226 Gastric cancer
    112313707 (NRAS)
   05214 Glioma
    112313707 (NRAS)
   05216 Thyroid cancer
    112313707 (NRAS)
   05221 Acute myeloid leukemia
    112313707 (NRAS)
   05220 Chronic myeloid leukemia
    112313707 (NRAS)
   05218 Melanoma
    112313707 (NRAS)
   05211 Renal cell carcinoma
    112313707 (NRAS)
   05219 Bladder cancer
    112313707 (NRAS)
   05215 Prostate cancer
    112313707 (NRAS)
   05213 Endometrial cancer
    112313707 (NRAS)
   05224 Breast cancer
    112313707 (NRAS)
   05223 Non-small cell lung cancer
    112313707 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112313707 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    112313707 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112313707 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112313707 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    112313707 (NRAS)
   05161 Hepatitis B
    112313707 (NRAS)
   05160 Hepatitis C
    112313707 (NRAS)
   05163 Human cytomegalovirus infection
    112313707 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112313707 (NRAS)
   05165 Human papillomavirus infection
    112313707 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112313707 (NRAS)
   01522 Endocrine resistance
    112313707 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112313707 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112313707 (NRAS)
   04031 GTP-binding proteins [BR:dro04031]
    112313707 (NRAS)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112313707 (NRAS)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112313707 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   112313707 (NRAS)
  Exosomal proteins of breast cancer cells
   112313707 (NRAS)
  Exosomal proteins of colorectal cancer cells
   112313707 (NRAS)
GTP-binding proteins [BR:dro04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112313707 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 112313707
NCBI-ProteinID: XP_024426079
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca
atccagctaatccagaaccactttgtagatgaatatgaccccaccatagaggattcttac
cgaaaacaggtggttatagacggtgagacctgcctgctggacatactggatacagctgga
caagaggagtacagtgccatgcgagaccagtacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcagatattaacctgtacagggaacagatt
aagcgagtcaaagactcagatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccgacaaggacagttgacacaaaacaagcccatgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatccgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgcatggggttgccttgtgtggtgatgtaa

KEGG   Desmodus rotundus (common vampire bat): 112317099
Entry
112317099         CDS       T05907                                 

Gene name
HRAS
Definition
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04062  Chemokine signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04137  Mitophagy - animal
dro04140  Autophagy - animal
dro04144  Endocytosis
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04510  Focal adhesion
dro04540  Gap junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04714  Thermogenesis
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04730  Long-term depression
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro05010  Alzheimer disease
dro05034  Alcoholism
dro05132  Salmonella infection
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112317099 (HRAS)
   04012 ErbB signaling pathway
    112317099 (HRAS)
   04014 Ras signaling pathway
    112317099 (HRAS)
   04015 Rap1 signaling pathway
    112317099 (HRAS)
   04370 VEGF signaling pathway
    112317099 (HRAS)
   04371 Apelin signaling pathway
    112317099 (HRAS)
   04630 JAK-STAT signaling pathway
    112317099 (HRAS)
   04068 FoxO signaling pathway
    112317099 (HRAS)
   04072 Phospholipase D signaling pathway
    112317099 (HRAS)
   04071 Sphingolipid signaling pathway
    112317099 (HRAS)
   04151 PI3K-Akt signaling pathway
    112317099 (HRAS)
   04150 mTOR signaling pathway
    112317099 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112317099 (HRAS)
   04140 Autophagy - animal
    112317099 (HRAS)
   04137 Mitophagy - animal
    112317099 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    112317099 (HRAS)
   04218 Cellular senescence
    112317099 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112317099 (HRAS)
   04540 Gap junction
    112317099 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    112317099 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112317099 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112317099 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    112317099 (HRAS)
   04660 T cell receptor signaling pathway
    112317099 (HRAS)
   04662 B cell receptor signaling pathway
    112317099 (HRAS)
   04664 Fc epsilon RI signaling pathway
    112317099 (HRAS)
   04062 Chemokine signaling pathway
    112317099 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112317099 (HRAS)
   04929 GnRH secretion
    112317099 (HRAS)
   04912 GnRH signaling pathway
    112317099 (HRAS)
   04915 Estrogen signaling pathway
    112317099 (HRAS)
   04917 Prolactin signaling pathway
    112317099 (HRAS)
   04921 Oxytocin signaling pathway
    112317099 (HRAS)
   04926 Relaxin signaling pathway
    112317099 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    112317099 (HRAS)
   04919 Thyroid hormone signaling pathway
    112317099 (HRAS)
   04916 Melanogenesis
    112317099 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    112317099 (HRAS)
   04726 Serotonergic synapse
    112317099 (HRAS)
   04720 Long-term potentiation
    112317099 (HRAS)
   04730 Long-term depression
    112317099 (HRAS)
   04722 Neurotrophin signaling pathway
    112317099 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    112317099 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    112317099 (HRAS)
   04213 Longevity regulating pathway - multiple species
    112317099 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    112317099 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112317099 (HRAS)
   05206 MicroRNAs in cancer
    112317099 (HRAS)
   05205 Proteoglycans in cancer
    112317099 (HRAS)
   05203 Viral carcinogenesis
    112317099 (HRAS)
   05230 Central carbon metabolism in cancer
    112317099 (HRAS)
   05231 Choline metabolism in cancer
    112317099 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112317099 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112317099 (HRAS)
   05225 Hepatocellular carcinoma
    112317099 (HRAS)
   05226 Gastric cancer
    112317099 (HRAS)
   05214 Glioma
    112317099 (HRAS)
   05216 Thyroid cancer
    112317099 (HRAS)
   05221 Acute myeloid leukemia
    112317099 (HRAS)
   05220 Chronic myeloid leukemia
    112317099 (HRAS)
   05218 Melanoma
    112317099 (HRAS)
   05211 Renal cell carcinoma
    112317099 (HRAS)
   05219 Bladder cancer
    112317099 (HRAS)
   05215 Prostate cancer
    112317099 (HRAS)
   05213 Endometrial cancer
    112317099 (HRAS)
   05224 Breast cancer
    112317099 (HRAS)
   05223 Non-small cell lung cancer
    112317099 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112317099 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    112317099 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112317099 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112317099 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112317099 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    112317099 (HRAS)
   05161 Hepatitis B
    112317099 (HRAS)
   05160 Hepatitis C
    112317099 (HRAS)
   05163 Human cytomegalovirus infection
    112317099 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112317099 (HRAS)
   05165 Human papillomavirus infection
    112317099 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112317099 (HRAS)
   01522 Endocrine resistance
    112317099 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112317099 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112317099 (HRAS)
   04031 GTP-binding proteins [BR:dro04031]
    112317099 (HRAS)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112317099 (HRAS)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112317099 (HRAS)
  Exosomal proteins of colorectal cancer cells
   112317099 (HRAS)
GTP-binding proteins [BR:dro04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112317099 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA ATP_bind_1 Septin Ldh_1_N
Other DBs
NCBI-GeneID: 112317099
NCBI-ProteinID: XP_024429880
Position
Unknown
AA seq 191 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSGSSSGTPVTQRPLALAWRMPSTHW
CARSGSTRCAS
NT seq 576 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtagtggtgggtgctggaggcgtggggaagagcgccctgacc
atccagctcatccagaaccacttcgtggacgagtatgaccccaccatcgaggactcctat
cggaaacaagtggtcatcgacggggagacgtgtctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgagggaccagtacatgcgcactggggagggcttcctctgc
gtgtttgccatcaacaacaccaagtccttcgaggacattcaccagtaccgggagcagatc
aagcgggtgaaggactcggatgatgtgcccatggtgctggtggggaacaagtgtgacttg
gctgcacgcacggtggagtctcggcaggcacaggacctcgcccgcagctacggcatcccc
tacattgagacctcggccaagactcgccagggcagccgctctggctctggctccagctcc
gggacccctgtgacccagcggccccttgcgctggcgtggaggatgccttctacacactgg
tgcgcgagatccggcagcacaaggtgcgcaagctga

KEGG   Desmodus rotundus (common vampire bat): 112318275
Entry
112318275         CDS       T05907                                 

Gene name
KRAS
Definition
(RefSeq) LOW QUALITY PROTEIN: GTPase KRas
  KO
K07827  GTPase KRas
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04062  Chemokine signaling pathway
dro04068  FoxO signaling pathway
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04137  Mitophagy - animal
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04540  Gap junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04714  Thermogenesis
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04730  Long-term depression
dro04810  Regulation of actin cytoskeleton
dro04910  Insulin signaling pathway
dro04912  GnRH signaling pathway
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04929  GnRH secretion
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro04960  Aldosterone-regulated sodium reabsorption
dro05010  Alzheimer disease
dro05034  Alcoholism
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112318275 (KRAS)
   04012 ErbB signaling pathway
    112318275 (KRAS)
   04014 Ras signaling pathway
    112318275 (KRAS)
   04015 Rap1 signaling pathway
    112318275 (KRAS)
   04370 VEGF signaling pathway
    112318275 (KRAS)
   04371 Apelin signaling pathway
    112318275 (KRAS)
   04068 FoxO signaling pathway
    112318275 (KRAS)
   04072 Phospholipase D signaling pathway
    112318275 (KRAS)
   04071 Sphingolipid signaling pathway
    112318275 (KRAS)
   04151 PI3K-Akt signaling pathway
    112318275 (KRAS)
   04150 mTOR signaling pathway
    112318275 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112318275 (KRAS)
   04137 Mitophagy - animal
    112318275 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    112318275 (KRAS)
   04218 Cellular senescence
    112318275 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112318275 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    112318275 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112318275 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112318275 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    112318275 (KRAS)
   04660 T cell receptor signaling pathway
    112318275 (KRAS)
   04662 B cell receptor signaling pathway
    112318275 (KRAS)
   04664 Fc epsilon RI signaling pathway
    112318275 (KRAS)
   04062 Chemokine signaling pathway
    112318275 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112318275 (KRAS)
   04929 GnRH secretion
    112318275 (KRAS)
   04912 GnRH signaling pathway
    112318275 (KRAS)
   04915 Estrogen signaling pathway
    112318275 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    112318275 (KRAS)
   04917 Prolactin signaling pathway
    112318275 (KRAS)
   04921 Oxytocin signaling pathway
    112318275 (KRAS)
   04926 Relaxin signaling pathway
    112318275 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    112318275 (KRAS)
   04919 Thyroid hormone signaling pathway
    112318275 (KRAS)
   04916 Melanogenesis
    112318275 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112318275 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    112318275 (KRAS)
   04726 Serotonergic synapse
    112318275 (KRAS)
   04720 Long-term potentiation
    112318275 (KRAS)
   04730 Long-term depression
    112318275 (KRAS)
   04722 Neurotrophin signaling pathway
    112318275 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    112318275 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    112318275 (KRAS)
   04213 Longevity regulating pathway - multiple species
    112318275 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    112318275 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112318275 (KRAS)
   05206 MicroRNAs in cancer
    112318275 (KRAS)
   05205 Proteoglycans in cancer
    112318275 (KRAS)
   05203 Viral carcinogenesis
    112318275 (KRAS)
   05230 Central carbon metabolism in cancer
    112318275 (KRAS)
   05231 Choline metabolism in cancer
    112318275 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112318275 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112318275 (KRAS)
   05212 Pancreatic cancer
    112318275 (KRAS)
   05225 Hepatocellular carcinoma
    112318275 (KRAS)
   05226 Gastric cancer
    112318275 (KRAS)
   05214 Glioma
    112318275 (KRAS)
   05216 Thyroid cancer
    112318275 (KRAS)
   05221 Acute myeloid leukemia
    112318275 (KRAS)
   05220 Chronic myeloid leukemia
    112318275 (KRAS)
   05218 Melanoma
    112318275 (KRAS)
   05211 Renal cell carcinoma
    112318275 (KRAS)
   05219 Bladder cancer
    112318275 (KRAS)
   05215 Prostate cancer
    112318275 (KRAS)
   05213 Endometrial cancer
    112318275 (KRAS)
   05224 Breast cancer
    112318275 (KRAS)
   05223 Non-small cell lung cancer
    112318275 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112318275 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    112318275 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112318275 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112318275 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    112318275 (KRAS)
   05161 Hepatitis B
    112318275 (KRAS)
   05160 Hepatitis C
    112318275 (KRAS)
   05163 Human cytomegalovirus infection
    112318275 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112318275 (KRAS)
   05165 Human papillomavirus infection
    112318275 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112318275 (KRAS)
   01522 Endocrine resistance
    112318275 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112318275 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dro04031]
    112318275 (KRAS)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112318275 (KRAS)
GTP-binding proteins [BR:dro04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112318275 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 MeaB G-alpha FeoB_N ATP_bind_1 Septin NPR1_interact AAA_25
Other DBs
NCBI-GeneID: 112318275
NCBI-ProteinID: XP_024431222
Position
Unknown
AA seq 188 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMMTGEGFLCVFALNNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
SKTKCVIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagtgggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacaatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcctggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgatgactggagagggctttttgtgt
gtatttgccttaaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgacttg
ccttctagaacagtagacacaaaacaggctcaggatttagcaagaagttacggaattcct
tttattgaaacatcagcaaagacaagacagggtgttgacgatgccttctatacattagtt
cgagaaattcgaaaacataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtgtaattatgtaa

DBGET integrated database retrieval system