KEGG   Desmodus rotundus (common vampire bat): 112304112
Entry
112304112         CDS       T05907                                 

Gene name
CD40
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 5
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04064  NF-kappa B signaling pathway
dro04514  Cell adhesion molecules
dro04620  Toll-like receptor signaling pathway
dro04672  Intestinal immune network for IgA production
dro05144  Malaria
dro05145  Toxoplasmosis
dro05166  Human T-cell leukemia virus 1 infection
dro05169  Epstein-Barr virus infection
dro05202  Transcriptional misregulation in cancer
dro05310  Asthma
dro05320  Autoimmune thyroid disease
dro05322  Systemic lupus erythematosus
dro05330  Allograft rejection
dro05340  Primary immunodeficiency
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112304112 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112304112 (CD40)
   04514 Cell adhesion molecules
    112304112 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112304112 (CD40)
   04672 Intestinal immune network for IgA production
    112304112 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    112304112 (CD40)
  09163 Immune disease
   05310 Asthma
    112304112 (CD40)
   05322 Systemic lupus erythematosus
    112304112 (CD40)
   05320 Autoimmune thyroid disease
    112304112 (CD40)
   05330 Allograft rejection
    112304112 (CD40)
   05340 Primary immunodeficiency
    112304112 (CD40)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112304112 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112304112 (CD40)
   05169 Epstein-Barr virus infection
    112304112 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    112304112 (CD40)
   05145 Toxoplasmosis
    112304112 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dro04050]
    112304112 (CD40)
   04090 CD molecules [BR:dro04090]
    112304112 (CD40)
Cytokine receptors [BR:dro04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   112304112 (CD40)
CD molecules [BR:dro04090]
 Proteins
  112304112 (CD40)
SSDB
Motif
Pfam: TNFR_c6 Adeno_E3_CR2
Other DBs
NCBI-GeneID: 112304112
NCBI-ProteinID: XP_024415499
Position
Unknown
AA seq 279 aa
MVLLPRQCLLVGFLLTAVHPEPLNVCRENQYLVNTQCCTLCLPGEKLVQDCTDTTPTLCH
PCGRGEFLDTPNNEKYCHPHKYCDPNLGLQVRMEGTTKTDTICVCNEGQHCVNDHCDSCA
PHSSCPPGDGVKQMATEVSDTVCEPCPVGFFSSVSSASEKCHPWTSCEVKGLVERRAGTN
KTDVFCDSQDRMRALVAVPVVMAVLLTALLVYACIKKVAEQANYKAFHPKGKRQDPVEID
MDDFPGPLPNHPVQETLHGCQPVTQEDGKESRISVQERL
NT seq 840 nt   +upstreamnt  +downstreamnt
atggttcttctccctcggcagtgtctcctcgtgggcttcttgttgaccgccgtccaccca
gaaccactcaatgtatgcagagaaaaccaatacctagtaaacactcagtgctgtactttg
tgtctgccaggagagaaactggtccaggactgcacggacaccacccccacactatgccac
ccttgcgggagaggcgagttcctggacaccccgaacaacgagaaatactgccacccgcat
aaatactgtgaccccaacctaggactccaggtgcggatggagggcactacgaaaacagac
acgatttgcgtgtgtaatgaaggccaacactgtgtcaatgaccactgcgacagctgtgcc
ccgcacagctcctgcccgcccggcgatggggtcaagcagatggctacagaagtttctgat
accgtctgcgaaccctgcccagtgggtttcttctccagtgtgtcatctgcttctgagaaa
tgtcatccttggacgagctgtgaggtcaaaggcctggtggagcggcgagcagggactaac
aagaccgatgtcttctgcgattcgcaggatcgaatgagagccctggtggcggtccccgtc
gtcatggcggtcctgttaactgccctgttggtgtacgcctgcatcaaaaaggtggctgag
caggcaaactataaggccttccatcctaagggcaaaaggcaagatcctgtggagatagat
atggatgattttcctggccccctccccaatcacccggtgcaggagaccttacacgggtgc
cagccggtcacgcaggaggatggcaaagagagccgcatctcggtgcaggagagactgtga

DBGET integrated database retrieval system