KEGG   Desmodus rotundus (common vampire bat): 112304393
Entry
112304393         CDS       T05907                                 

Gene name
CD72
Definition
(RefSeq) B-cell differentiation antigen CD72
  KO
K06504  CD72 antigen
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    112304393 (CD72)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dro04090]
    112304393 (CD72)
   04091 Lectins [BR:dro04091]
    112304393 (CD72)
CD molecules [BR:dro04090]
 Proteins
  112304393 (CD72)
Lectins [BR:dro04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   112304393 (CD72)
SSDB
Motif
Pfam: Exonuc_VII_L DUF1664 Na_trans_assoc DUF4714 Fez1 HrpB7 DUF3086 DUF3450 DUF4407 Spc7 UPF0242 FapA FliJ FliD_N HIP1_clath_bdg
Other DBs
NCBI-GeneID: 112304393
NCBI-ProteinID: XP_024415751
Position
Unknown
AA seq 263 aa
MAESVTYADLRFVKAPLKKRISSHLGQDPEADDDGELTYENVQVLPISGGASSLASSGPG
DKARRSAFSKYLLGLLLTCLLLGMAAISLGVRYLQVSQQLQHMNRVLEATNSSLRQQLHL
KITQLGQREQDLQGSRRELAQSQEALEVKQKDYQAVKEQLQACQSDSKVTKETLQREEEQ
RRKLEERLNSMRDTLRPYFTGPADHCCPVGWVLMEKKCFYISAVKRSWEESKSFCNTLSS
SLATIDYSYSVSIPLFTDCLGYF
NT seq 792 nt   +upstreamnt  +downstreamnt
atggctgagtctgtcacctacgcggacctgcggtttgtgaaggctcccctgaagaagaga
atctccagccatttagggcaggatccagaggctgacgatgatggggagctcacctatgag
aatgtacaagtgctcccaatctcagggggagcctcaagcttggcttcctctggaccagga
gacaaagctcgccgttcagccttctcgaaatacctcctgggcctgctcctcacctgcctg
ctgttagggatggctgctatctccctgggagtgcgctatctgcaggtgtctcagcagctc
cagcacatgaacagggttctggaggccactaacagcagtctgaggcagcaactccacctg
aagatcacccagctggggcagagggaacaggatctgcaggggtccaggagggagctggcc
cagagtcaggaagcactagaggtgaaacagaaggattaccaggctgtcaaggagcagtta
caggcctgccagtcggacagcaaggtgacaaaggagactttgcaaagggaggaggaacag
aggaggaagctggaggagaggctgaatagcatgcgggacacactgaggccctacttcacg
ggcccagcagaccactgctgtcccgtgggatgggtactgatggagaagaaatgcttttac
atctcagctgttaagagaagttgggaagagagcaaaagcttttgtaatactctgtcctcc
agcctggccacaattgactattcgtattcagtaagcatacctttattcacagactgtctt
gggtacttttag

DBGET integrated database retrieval system