KEGG   Desmodus rotundus (common vampire bat): 112304655
Entry
112304655         CDS       T05907                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04620  Toll-like receptor signaling pathway
dro04622  RIG-I-like receptor signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04630  JAK-STAT signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04940  Type I diabetes mellitus
dro05133  Pertussis
dro05134  Legionellosis
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05143  African trypanosomiasis
dro05144  Malaria
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05152  Tuberculosis
dro05162  Measles
dro05164  Influenza A
dro05168  Herpes simplex virus 1 infection
dro05200  Pathways in cancer
dro05321  Inflammatory bowel disease
dro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112304655 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112304655 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112304655 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    112304655 (IL12A)
   04625 C-type lectin receptor signaling pathway
    112304655 (IL12A)
   04658 Th1 and Th2 cell differentiation
    112304655 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112304655 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    112304655 (IL12A)
   05330 Allograft rejection
    112304655 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112304655 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    112304655 (IL12A)
   05134 Legionellosis
    112304655 (IL12A)
   05152 Tuberculosis
    112304655 (IL12A)
  09172 Infectious disease: viral
   05162 Measles
    112304655 (IL12A)
   05164 Influenza A
    112304655 (IL12A)
   05168 Herpes simplex virus 1 infection
    112304655 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112304655 (IL12A)
   05144 Malaria
    112304655 (IL12A)
   05145 Toxoplasmosis
    112304655 (IL12A)
   05140 Leishmaniasis
    112304655 (IL12A)
   05142 Chagas disease
    112304655 (IL12A)
   05143 African trypanosomiasis
    112304655 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112304655 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112304655 (IL12A)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Interleukins
   112304655 (IL12A)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Haparin
  Cytokines
   112304655 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 112304655
NCBI-ProteinID: XP_024416062
Position
Unknown
AA seq 219 aa
MRPPRSLLLVATLVLLHHLSLARNLPTTPAGPEPSQCLSHAQNLLVAVSNTLHKAMQTLE
FYSCSSEEVDHKDITKDKTSTVEACLPQELTTDESCLVSREISFTTNGTCLASRKASFMM
TLCLSSIYEDLKMYQVEFKAISAKLLMDPKRQITLDPNMLAAIDELMQVLKSNSETVPPK
PSLGELDFYKTKIQLCVLLHAFRNRAVTIDRVMSYLSSS
NT seq 660 nt   +upstreamnt  +downstreamnt
atgcgcccaccacgcagcctcctccttgtggccaccctggtcctcctacaccacctcagt
ttggccaggaacctccccaccaccccagcaggcccagaaccgtcccagtgcctcagtcac
gcccagaacctgctggtggctgtcagcaacactctgcacaaggccatgcaaactctagaa
ttttactcctgcagttctgaagaggtcgatcataaagatatcacaaaagataaaacgagc
acagtagaggcctgcttaccccaagaattaaccacggatgagagttgcctggtttccaga
gagatctctttcacaactaatgggacctgcctggcctccagaaaggcctcttttatgatg
accctgtgccttagtagtatctatgaagacctgaagatgtaccaagtggagttcaaggct
atcagtgcaaagctgttgatggatcctaagaggcagatcactctggatccaaacatgctg
gcagctattgatgagctgatgcaggtcctgaagtccaacagtgagacggtgccacccaag
ccctccctaggagaactggatttttacaagacaaaaatccagctctgcgtcctccttcat
gctttcagaaaccgtgcagtgaccattgacagggtgatgagctatctgagctcttcctaa

DBGET integrated database retrieval system